KEGG   Agrobacterium sp. H13-3: AGROH133_09229Help
Entry
AGROH133_09229    CDS       T01432                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00330  Arginine and proline metabolism
agr00332  Carbapenem biosynthesis
agr01100  Metabolic pathways
agr01130  Biosynthesis of antibiotics
agr01230  Biosynthesis of amino acids
Module
agr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AGROH133_09229 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AGROH133_09229 (proB)
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AGROH133_09229 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADY65695
UniProt: F0L4R6
Position
circular:complement(2766698..2767867)
Genome map
AA seq 389 aa AA seqDB search
MSLTRKPLGSHHRIVIKIGSALLVDRKSGLKKDWLDAICEDIAALKKNGADVQVVSSGAI
ALGRTVLGLPSGALKLEESQAAAAVGQIALARAWSESLSRHEIVAGQILLTLSDTEERRR
YLNARATINQLLKIGAIPIINENDTVATTEIRYGDNDRLAARVATMTGADLLVLLSDIDG
LYTAPPHLDPGAKFLETIADITPEIEAMAGGAASELSRGGMRTKIDAGKIATAAGCGMII
ASGKTLNPLKAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGEIHVDAGAEKALYAGKS
LLPAGVRVVKGNFGRGDAIAIIGVEGREVARGLAGYDAEEARLIIGHKSNEIEAILGYVG
RAAMIHRDDLVMTGAAVKVKNTEKDKVHA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcacccgcaaaccgctgggtagccaccaccggatcgttatcaagatcggttcg
gcacttctggtggaccggaaaagcgggctgaagaaagattggctcgacgccatttgcgag
gacatcgctgcgctgaagaaaaacggcgcagatgttcaggtggtgtcttctggtgccatc
gcgctcggccgcacggtgctcggtctgccctccggcgcattgaagctggaggaaagccag
gcagcggcggccgttggtcagatcgctctggcgcgggcatggtcggaaagcctgtcgcgg
catgagatcgttgctggccagattctgctcacgctgtccgacaccgaggagcgccgccgt
tacctcaatgcgcgcgccaccatcaaccagctgctgaagatcggtgccattccgatcatc
aatgaaaacgacacggtggcaaccaccgaaatccgctacggcgacaatgaccgtctggcc
gcccgcgtggccaccatgaccggtgccgatcttctggtattgctgtctgatattgacggg
ctttacacggctccgccgcatcttgatccgggtgcgaagttccttgagacgattgcagat
attacgcccgagattgaggccatggcaggcggtgcggcttccgagctttcacgcggcggc
atgcgtaccaagatcgatgccggcaagatcgcgaccgctgccggttgcggcatgatcatc
gcttccggcaagacgctcaatccgttgaaggccatcgaaaacggcgcccgctcctcgtgg
tttgcgccatcaggcacaccggtgacggcgcgaaagacctggattgccggtcagttgcag
ccggcaggtgagattcatgtggatgcgggtgcggaaaaagcgctctatgccggtaaaagc
ctgcttcccgcgggcgtgcgggtggtgaagggcaattttggacgcggcgatgcgattgcc
attatcggcgttgaaggccgagaggtcgcgcgcggccttgcaggctacgatgcggaagag
gcgcgtcttatcatcggtcacaagtccaacgagatcgaggcgatacttggctatgtcggg
cgtgcggcgatgatccatcgcgacgatctggtgatgacgggtgccgccgtgaaagttaaa
aatactgaaaaggataaggtccatgcctga

DBGET integrated database retrieval system