KEGG   Agrobacterium sp. H13-3: AGROH133_09375Help
Entry
AGROH133_09375    CDS       T01432                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
agr  Agrobacterium sp. H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_09375
Secretion system [BR:agr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AGROH133_09375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N Couple_hipA HTH_53
Motif
Other DBs
NCBI-ProteinID: ADY65792
UniProt: F0LDA6
Position
linear:42324..43379
Genome map
AA seq 351 aa AA seqDB search
MNAPNVKTDVEFLNDCGENIRVNARTREIYYRIKDERNQARTEERAASPQDNLKISSSWD
NVSNLGLQIIYSESKDVEILAWLAEASLRLRGFHGLREIYDLGKELFYNHWDSLRSISDD
NDEEKFAPLAGLNGVGSEGTLVQPLRLASLIPGGKFGEHSLWDFQLAQRPNESKRREELY
RLASETGVAAMSSQLAEVTACLSSFDAIMAILAERCGQSAPPSSNIRNTLVEAASAIRSL
GGRDQEPASVEQEPVGISGSDESGPAAARPAVTAPEGILSRDEAFETLLSVARYFRRTEP
HSPISLAIETLVRRGRMDFSELLAELLPEAQVRNAVLTAAGIKPSGESNGK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcgccgaacgttaaaacagatgtagaatttctgaatgactgcggagaaaatatc
cgggtcaacgcaagaacgcgtgaaatatactatagaattaaggatgaaagaaaccaagct
cgtacagaagagcgcgccgcttctccgcaggataacctgaaaatatccagtagctgggat
aatgtcagcaatcttggattgcagattatatattccgaaagcaaggatgttgaaatattg
gcgtggcttgcggaagcatcgctgcgcctgcgcggctttcatggtctgcgcgaaatctac
gacctcggcaaagagctgttttacaaccactgggactcgctgcggtcaatcagcgacgat
aatgacgaagaaaaatttgcacctttagcgggattgaacggtgtcggcagcgaaggaacg
cttgttcagcctttgcgcctcgcctcattgatcccaggcggcaaatttggcgaacacagc
ctatgggactttcaactcgcgcagcgcccaaatgagagcaaacgtcgcgaagagctatat
cggcttgcgtctgaaactggcgttgccgccatgtcatcccagttggcagaggtgactgcg
tgcctctcctcgtttgatgccatcatggccatccttgccgagcgctgcgggcaatccgca
ccaccgagttccaatatccgcaacacgctggtcgaagcagcgtctgcaattcgctcgctc
ggcgggcgtgaccaggagccggcatccgtcgaacaggaacctgtgggcatcagcggttca
gacgagagcgggccggcggccgcgcggcccgccgtgaccgcaccggaaggcatattatcg
cgcgacgaagcatttgaaactcttctctcggttgcgcgttacttccgccgtaccgagccg
cattcaccgatctcccttgccatagagacactggtgcgcaggggacgcatggatttttcg
gaactgctggccgagcttttgccggaagcccaggttcgcaacgcagtcttaaccgccgcc
ggcatcaagccaagcggagagagcaacggaaaatag

DBGET integrated database retrieval system