KEGG   Agrobacterium fabacearum H13-3: AGROH133_09376
Entry
AGROH133_09376    CDS       T01432                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
agr  Agrobacterium fabacearum H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_09376
Secretion system [BR:agr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AGROH133_09376
SSDB
Motif
Pfam: T6SS_VipA MINDY_DUB
Other DBs
NCBI-ProteinID: ADY65793
UniProt: F0LDA7
Position
linear:43445..43954
AA seq 169 aa
MASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKPFGERKFV
QIDRDNFDEVMRRMTPGLNISVANTLQKDGTDMQVNLKFESMDDFEPGAVVQQVPALKAL
LDARNELRDLLSKADRSEDLERMLEDILQNKTDLATLVSELKEKNGANE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcaagtgtacatgagaagctggagcgtgttcgcaaaccacgcgttcacatcaaatac
gaagtcgaaaccgaaggcgcgatggtagtcaaggaactgcctttcgtggtcggtgtgctc
ggtgatttctccggcaatcccacccagccgctcaagccgttcggggagcgtaaattcgtt
cagatcgaccgcgacaatttcgacgaagtcatgcggcgcatgacgcccggcctcaatatt
tccgttgccaatacgctgcaaaaggatggcacggacatgcaggtcaacctgaagttcgaa
agtatggatgatttcgaacccggcgctgtcgtgcagcaggttccggcgctcaaggcgctt
ttggatgcccgcaacgaactgcgcgaccttctttccaaggccgaccgttcggaagatctg
gagcggatgctggaggatattctgcaaaacaagaccgacctcgcaacgctggtttccgaa
ctcaaggaaaagaacggcgcgaacgaataa

DBGET integrated database retrieval system