KEGG   Agrobacterium sp. H13-3: AGROH133_09378
Entry
AGROH133_09378    CDS       T01432                                 

Definition
(GenBank) hypothetical protein
  KO
K11899  type VI secretion system protein ImpD
Organism
agr  Agrobacterium sp. H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_09378
Secretion system [BR:agr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AGROH133_09378
SSDB
Motif
Pfam: VipB VipB_2 DUF4637
Other DBs
NCBI-ProteinID: ADY65795
UniProt: F0LDA9
Position
linear:45588..46982
AA seq 464 aa
MAHQSFTDARIFADQLIALIDDALTGQVNAILHHPDFQAMEARWRGLAMVVREAGRSTDV
KVKLLNASWRDLARNTERATDFDQSHLFEAVYNREFGMPGGEPVGLLIGDYAFSPDDLDG
ADSITTLSQIGMVAAAAFCPFVAAASPSTVGLQDFSELSRVHDFSWLKQEKSRLRWNALR
ARDDSRFVGLVAPRVLLRSPYRPYARRRDDGFPFREHVAESGETLLWGNAAFAFATVVVR
NFVDSGWFADLRGVTQDAVDGGMLSARQLPPLDLGIESNGLSAQPPVEVQLTTGQEQQFS
DLGIVPVSTTYLSGMAIFNANQSLHAPGHYSTEAARQNARLAAMLQYVLCASRFSHYLKV
IMRDDIGQLSDATTIERKLESWLSSYTLGNDDAEAALRIRYPLRSAGINVFEVPGKPGTF
SCTVRLQPHFQLDDVSTSFHLIAETMMPATAASRPSAEPQRISA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcgcatcagtccttcacggacgcccgtattttcgccgaccagctcatcgccctcatc
gacgatgcgctgaccggccaggtgaacgctattctccaccatcctgattttcaggcgatg
gaggcgagatggcgcgggcttgccatggtcgtgcgcgaggcgggccggagcaccgacgtg
aaggtgaaactgctgaacgccagctggcgcgaccttgcccgcaacacggaacgcgccacc
gacttcgaccagagccatcttttcgaggccgtctataaccgcgaatttggcatgccgggc
ggcgaaccggtcggccttctgatcggtgactacgccttttcccctgatgatcttgatggt
gccgattccatcacaacgctgtcacagatcggcatggtggctgcggccgccttctgccct
ttcgtagcggcggcttcgccctccaccgttgggctgcaggacttttcggagctcagccgg
gtccatgacttttcctggctgaaacaggagaaatcgcggctgcggtggaatgcgcttcgc
gcacgcgacgattcacgcttcgtaggccttgtcgcaccgcgcgttttgctacgttctccc
tacaggccctatgcgcgccggcgggatgacggatttccattccgcgagcatgtggcggaa
agcggcgagaccctgctgtggggcaacgccgcctttgccttcgcaacggttgtggtgcgc
aatttcgtcgattccggctggtttgcggatctgcgcggtgtgacacaggacgccgtggat
ggcggcatgctctctgcccgacaattgccaccgcttgatctcggcatcgagagtaacggc
ctgtccgcccagccgcccgtggaagtgcaactgacgactgggcaggaacagcaattttcc
gatctgggcatcgtacccgtctccacaacctatctttccggcatggcgatcttcaacgcc
aaccaatccctgcatgcaccaggccattactccaccgaagcggcgaggcagaacgcccgc
ctcgctgccatgctgcaatatgtgctgtgtgcctcccggttctcgcattacctcaaggtc
atcatgcgcgatgacatcggccagctcagcgatgccacgaccatcgagcgtaaactggaa
agctggctttcctcctatacgctcggcaacgacgatgcggaggcggcgttgcgcatccgc
tatccgctgcgctctgcagggatcaatgtcttcgaggttcccggcaagcccggaacattc
tcatgcaccgtgcgccttcagccgcatttccagctcgatgacgtctccacgagcttccac
ctcattgccgaaaccatgatgccggccaccgccgcatcccggccttcggccgagccgcaa
aggatatccgcatga

DBGET integrated database retrieval system