KEGG   Agrobacterium sp. H13-3: AGROH133_09381
Entry
AGROH133_09381    CDS       T01432                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
agr  Agrobacterium sp. H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_09381
Secretion system [BR:agr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AGROH133_09381
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADY65798
UniProt: F0LDB2
Position
linear:48295..50076
AA seq 593 aa
MAEGFLEKYNDELFALRKRASRFAAAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARV
RQKLDDEFPELSDSLLETLYPHYLAPIPSMSVVQFAPSPALATVQTLPRHSEILAEPVGG
ESCRFRTTQDVEIVPLEIAAATLTGQPIDAPFSASFAGAASCLRLSLRSTAPRSGTFPEM
GLTKLQIFLSAAWQQATALYELLTNHCVGMALARHAEDKEAVFLPAGSLTPSGYSRDKAM
LPYPANSFDGYRLLTEFFALPQKFLFLDIDGLQKWGGGDCELYIYLDAADTRLERMVSVR
DFVLNASPVINLFKQSCEPLSLDGTRTEYRLLPDARRQRTREIYAVENVQLTSRSGQTEK
TSPFFGRTQRNNGANVYWQIQRRFDDDGSSDTDIAFVDQKRGPLGPLDMVASIDTLCLNR
ELPSQLPFGGGHPFLQLSTGNEAVKSIHALMPPTEAIRVNERSAREWRLISHLLLNHLSL
TDNGGAPLKDILSLYSFRDSPETRQIVEAISNVEAQNSHARIGSAMVPGTDITVEFDPAL
IARPAAFVFAGVLNHFFGLYTSINSFTRLTATMRGHSKPIARWPARAADRPLL
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggctgaaggcttcctcgaaaagtacaatgacgagctttttgcgctgcgaaagcgcgca
tctcgtttcgcggcggcgtttccgaagatcgccggcaggctgcggatgacgggcgacgtt
gccgacgatccgcatgtcgagcgtctgatccagagtttcgcctactccgccgcccgggtg
cgccagaagctggatgacgaattccccgaactgtcggacagtctgctggaaacgctctat
ccacattatcttgccccgatcccttcgatgagcgtcgtgcaattcgctccgagcccggcg
ctggcaaccgtgcagacgcttccccgccacagcgaaattctcgccgaaccggttggcggc
gaaagctgccgtttccgcaccacgcaggacgtcgagatcgttccactggagatcgcagct
gccacactcaccggtcagccgatcgacgcccctttttcggcgtcctttgccggcgcggcc
agctgtttgaggctttcgctacgcagcacggccccgcgcagcggtactttcccggaaatg
ggactgacgaaactccagattttcctgtccgccgcatggcagcaggcgacagcgctttac
gagcttttgaccaaccattgcgtcggcatggcgcttgcgcgtcacgccgaggacaaggaa
gccgttttcctgcccgccggaagtcttacgccgtccgggtactctcgcgataaagccatg
ctgccatatccagccaacagttttgatggataccggcttctcaccgaattcttcgcgctg
ccgcagaaatttctgtttctcgatattgacggcctgcagaaatggggcggcggcgactgc
gagctatacatttatctggatgcggcggacacgcggcttgagcgcatggtgtcggtcaga
gattttgtgttgaacgcctcaccggtgatcaacctgttcaaacaaagttgcgaaccgctc
agtcttgatggtacgcggacggaatacaggttgctgccggatgcacggcggcagcggacg
cgcgagatctatgccgttgaaaacgttcaactgaccagccgttccggacagaccgagaag
acgtctccgttttttggtcgcacacagcgcaataatggcgcaaacgtttactggcagata
cagcgccggttcgatgatgacggctcttccgatacggacatcgccttcgtggatcagaag
cgcggcccgcttgggccgctcgacatggtggcaagcattgatacactttgcctcaaccgc
gaactgccaagccagcttccctttggcggcgggcacccattcctgcaactttctaccggc
aacgaggcggtgaaatccatccatgcgctgatgccgccgacggaggcgatccgcgtcaac
gagcgttcggcacgcgagtggcggctgatctcacatcttctcctcaaccatctctcgctc
accgacaacggcggcgcgccgctgaaggacattctctcgctttattccttcagggacagc
ccggaaaccagacagatcgtagaggcgatcagcaatgtcgaggcgcagaattctcatgcc
cggattggctcggcaatggtaccgggaacagatatcacggtggagtttgacccggcactg
atcgcgcgacctgccgcatttgttttcgccggcgtcctcaaccatttcttcgggctctac
acctcgatcaacagtttcacgcgactgacggcgacgatgcgaggccactccaaaccgatt
gcccgctggccagcccgcgcggccgaccggccgctgctttag

DBGET integrated database retrieval system