KEGG   Agrobacterium sp. H13-3: AGROH133_10065Help
Entry
AGROH133_10065    CDS       T01432                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00071  Fatty acid degradation
agr00072  Synthesis and degradation of ketone bodies
agr00280  Valine, leucine and isoleucine degradation
agr00310  Lysine degradation
agr00362  Benzoate degradation
agr00380  Tryptophan metabolism
agr00620  Pyruvate metabolism
agr00630  Glyoxylate and dicarboxylate metabolism
agr00640  Propanoate metabolism
agr00650  Butanoate metabolism
agr00900  Terpenoid backbone biosynthesis
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
agr01212  Fatty acid metabolism
agr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AGROH133_10065
   00630 Glyoxylate and dicarboxylate metabolism
    AGROH133_10065
   00640 Propanoate metabolism
    AGROH133_10065
   00650 Butanoate metabolism
    AGROH133_10065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_10065
   00072 Synthesis and degradation of ketone bodies
    AGROH133_10065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AGROH133_10065
   00310 Lysine degradation
    AGROH133_10065
   00380 Tryptophan metabolism
    AGROH133_10065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AGROH133_10065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AGROH133_10065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AGROH133_10065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:agr04147]
    AGROH133_10065
Enzymes [BR:agr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AGROH133_10065
Exosome [BR:agr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGROH133_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt HMG_CoA_synt_N DUF2059
Motif
Other DBs
NCBI-ProteinID: ADY66068
UniProt: F0LER4
Position
linear:359708..360877
Genome map
AA seq 389 aa AA seqDB search
MSKAQIVGWAHSPFGKSALENTEQLMASVVAPAIDHAGVDVSDIDGIFVGVMNNGFSKQD
FQGALVAMGDERLAYTPAVRFENACSTGSAALYSAMDFIEAGRGRIALVVGAEKMTALPT
AEVGEILLSACYRAEEANIPGGFAGQFGRIAQAYFQRYGDRSEELAMIAAKNHANGAVNP
YAHMRKDFGFDFCNTVSDKNPYVAGPLRRTDCSLISDGAAAIILADEETAATLNRAIGFR
GRKHVNDIMALSRRDPLAFEGARRAWAGSLELAGATLDDLSFVETHDCFTIAELIEYEAM
GLAKPGEGYRVVQDGTALKTGSLPINPSGGLKSKGHPVGATGVSMHVMAAMQLMGEAGDM
QIPHASLAGVFNMGGTAVANYVSIMERVK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcgcagatcgtcggctgggcgcattcgcctttcggcaagtcggcccttgaa
aataccgagcaactgatggcttcggtcgtggcgccggccatcgaccatgcgggcgtcgat
gtcagcgatatcgacggcattttcgtcggcgtgatgaacaatggcttctcgaaacaggat
tttcagggcgccctggtggcgatgggcgatgagcgcctcgcctatacgccggcagtgcgt
ttcgagaatgcctgctcaacaggatcggccgccctctacagcgccatggatttcatcgaa
gccgggcgcggccgcatcgcactcgttgtcggcgccgaaaaaatgacggcgctgccgacc
gcagaggtgggcgaaatcctgctctccgcctgttaccgtgcggaggaggccaatattccc
ggaggatttgctggtcagttcggccgcatcgcacaggcgtattttcaacgttatggcgac
cgctccgaagagctggcgatgattgccgcaaagaaccacgccaatggcgcggtcaatccc
tatgcacatatgcgcaaggatttcggcttcgatttctgcaatacggtttcggacaagaac
ccctacgtcgcaggcccgctgcgccgcaccgactgctcgctgatttctgacggcgctgcc
gcgatcattttggccgacgaggaaacggcagccacactcaaccgcgccatcggtttcagg
ggccgcaagcatgtcaacgacatcatggcattgagccgtcgcgatccgttggccttcgaa
ggcgcgcgccgcgcctgggccggctcgctggaacttgccggagcaacgctcgacgacctc
tctttcgttgaaacgcacgactgcttcaccattgccgaacttatcgaatatgaggccatg
gggcttgcgaagcccggtgaaggatatcgcgttgtccaggatggaacggccctgaagacc
ggaagcctgccaatcaacccatcgggtggattgaaatcgaaaggtcatcccgtcggggcg
accggcgtttccatgcatgtcatggcggcgatgcaattgatgggcgaggcaggcgacatg
caaattccccatgcctcgctggctggcgtgttcaacatgggtggcacggcggttgccaat
tacgtctcgatcatggagcgtgtgaaatga

DBGET integrated database retrieval system