KEGG   Agrobacterium sp. H13-3: AGROH133_10890Help
Entry
AGROH133_10890    CDS       T01432                                 

Definition
(GenBank) ribose ABC transporter, nucleotide binding/ATPase protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:agr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AGROH133_10890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:agr02000]
    AGROH133_10890
Enzymes [BR:agr01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     AGROH133_10890
Transporters [BR:agr02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    AGROH133_10890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 AAA_23 RsgA_GTPase Arc_PepC MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADY66380
UniProt: F0LAZ8
Position
linear:703251..704774
Genome map
AA seq 507 aa AA seqDB search
MSETAPLLEARAIGKSFLGITALDGVDFSLGRGEIHALLGENGAGKSTLIKILTGVYHRD
SGSIFLEGSEISPTNVGEAQALGIGTVYQEVNLLENLTVAENLFLGRQPHRFGLIDRASM
QRQSQALLSQYGLSIDVNALLSSYSVAIRQIIAIARAVDLSGKVLVLDEPTASLDAHEVE
MLFGVLRKLRARGIGIVIITHFLNQVYDIADRVTVLRNGRLVGTRDIGNLPRSELIAMML
GRELQHITHEHQATDDTVAEGEPPIRFEGYGKRGSIAPFDLGIRPGEIVGVAGLLGSGRT
ETAFLLFGIDKPDTGKATIDGKTIALSSPEAAITAGFGFCPEERKTDGIIGDFSVTDNIA
LALQARQGWARPLSRRQKAELAESFIKSLDIRPADPDRPIKFLSGGNQQKAILARWLATH
PRLLILDEPTRGIDIGAHAEILKMIEKLCTEGMSLVVISSELEELTAVAHRVVVLSDRRH
VSELKGGEVTADNIMRAIADAARTEAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaacggcaccacttctggaagcacgcgccatcggtaaatcctttctcgggata
acggcgctggacggcgtcgatttttcgctcgggcgcggtgaaattcacgcgcttctcggc
gaaaacggcgcggggaaatcaacactcatcaagatactgaccggcgtttaccaccgcgac
agcggctccatctttctggaaggtagcgagatatcgcccaccaatgtcggcgaagcgcag
gccctcggtatcggcaccgtctatcaggaagtaaaccttctcgaaaatctgactgttgct
gaaaatctctttctcggccgccaaccgcatcgcttcgggctcattgacagagcctcgatg
cagagacaatcgcaggcgctgctgtcccaatacggcctttcaatcgacgtcaatgccctg
ctttccagctattccgtggctatccgccagatcatcgccattgcccgcgccgtcgatctt
tccggcaaggtgttggtgctggacgagccgaccgccagcctcgatgcccatgaggtcgag
atgctgttcggcgtgctgcggaaattgcgcgcccgcggcatcggcatcgtcataatcacc
cacttcctaaaccaggtctacgatatcgccgaccgggtgacggttctgcgcaacggtcgc
ctcgtcggcacccgcgacatcggcaacctgccgaggtccgaactcatcgccatgatgctt
ggtcgcgagcttcagcacatcacccacgagcatcaggccactgacgacacggttgccgag
ggcgaaccgccgatccgtttcgaggggtacggcaaacgcggcagcatcgcccccttcgac
ctcggcattcgtccgggagagatcgtcggcgtcgccggtcttttggggtcgggacgaacg
gaaacggctttcctgctgttcggcatcgacaagcccgataccggcaaggccacgatagac
ggaaagacaatcgctctttcttcgcctgaagccgcaattacggccgggttcggtttctgc
ccggaggagcgcaagactgacggtatcatcggcgacttttccgtgaccgacaatattgct
ctggctctccaggcccgccaggggtgggcgcggccgctttcgcgccggcagaaggcggaa
ctggccgaaagcttcatcaaatcgctggacatccgcccggccgatcctgaccggccgata
aaattcctttccggcggcaaccagcagaaagccattctggcgcgctggcttgcaacccat
ccccggcttctgatcctcgatgagccgacccgtggtatcgatatcggcgcccatgcggaa
atcctcaaaatgatcgaaaaactctgcaccgagggcatgtcgctcgtcgtcatctcgtcc
gaactggaagaactgaccgccgttgcccaccgggtcgtcgtgctgtccgaccgccggcat
gtcagcgaattgaagggcggcgaggtgacggccgacaacatcatgcgggcaattgcggat
gcggccagaacggaggcggcatga

DBGET integrated database retrieval system