KEGG   Agrobacterium sp. H13-3: AGROH133_11679Help
Entry
AGROH133_11679    CDS       T01432                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00071  Fatty acid degradation
agr00280  Valine, leucine and isoleucine degradation
agr00281  Geraniol degradation
agr00310  Lysine degradation
agr00360  Phenylalanine metabolism
agr00362  Benzoate degradation
agr00380  Tryptophan metabolism
agr00410  beta-Alanine metabolism
agr00627  Aminobenzoate degradation
agr00640  Propanoate metabolism
agr00650  Butanoate metabolism
agr00903  Limonene and pinene degradation
agr00930  Caprolactam degradation
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01212  Fatty acid metabolism
Module
agr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AGROH133_11679
   00650 Butanoate metabolism
    AGROH133_11679
  Lipid metabolism
   00071 Fatty acid degradation
    AGROH133_11679
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AGROH133_11679
   00310 Lysine degradation
    AGROH133_11679
   00360 Phenylalanine metabolism
    AGROH133_11679
   00380 Tryptophan metabolism
    AGROH133_11679
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGROH133_11679
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AGROH133_11679
   00281 Geraniol degradation
    AGROH133_11679
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AGROH133_11679
   00627 Aminobenzoate degradation
    AGROH133_11679
   00930 Caprolactam degradation
    AGROH133_11679
Enzymes [BR:agr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AGROH133_11679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ADY66679
UniProt: F0LC69
Position
linear:complement(1045368..1046438)
Genome map
AA seq 356 aa AA seqDB search
MEVATEAETQVVIGRRVGAGIIHLNRPKAINSLTLPMVRAMLQALHRFEDDPDVSCVVLT
GEGDRGLCAGGDVRIIHDLGKAGDPQVLDFWREEFPLNYRIARFGKPYVALMDGIVMGGG
VGISAHASHRIVTERTKLAMPETGIGYFPDVGGSWLLPRAPGECGTWLGLTGNAVTAADA
IYAGFADCFVPSARLTDLVENLSQALDPDGVEAVIGTYAVEAGEGVLSAHREIIDAAFRF
DTVEEIFAALSERDDTFSRETLEILKKRSPTSLKLTLKLLRLGRESASLIECLEREFAAG
TEILRGHDFYEGVRAALVDKDRNPRWRPAQLEEVREEDLLPYFTKHSGNLFPEHRL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggaagttgcaacggaagcggagacgcaggtcgtcatcggaagacgggtaggggcgggc
atcatccacctgaaccgtccgaaagccatcaacagcctgacgctgccgatggttcgtgcc
atgctccaggcgcttcaccgtttcgaggatgaccctgacgtttcctgcgtggtgctgaca
ggagaaggcgacagggggctctgtgcggggggtgacgttcgcatcattcacgatctcggc
aaagcgggcgatccgcaggtgctggatttctggcgcgaagagtttccgctgaattatcgc
attgcccgctttggtaaaccttatgtcgcgttgatggacggcatcgtcatgggtggcggc
gtcggcatttccgcccatgccagccaccgcatcgtcaccgagcggacgaagcttgccatg
ccggaaaccggtatcggctatttccctgacgtcggcggttcatggcttttgcccagagcg
ccgggcgaatgtggcacctggctggggctgacaggcaatgcggtcactgctgccgatgcg
atctatgccggttttgccgattgtttcgtcccttctgcgcgccttacagatttggtggag
aatctatcacaagcgctcgatcctgatggtgtcgaggcggtaatcggaacttatgccgtc
gaagctggtgagggggtcctgtcggcacaccgtgagatcatcgacgcggcattccgtttc
gacacggtcgaggagattttcgcagcactttcggagcgtgacgatacgttttcgcgcgag
actctggaaattctcaaaaaacgctcccctaccagtctcaaactaaccctgaagctgctg
cgcctggggcgggaaagcgccagcctcatcgaatgcctcgaacgggaatttgccgccggc
acggagatattgcggggtcatgatttttatgagggcgtgcgtgcggccctggtcgacaag
gaccgcaatccgcgctggcgaccggcacagctggaagaggtgcgtgaagaagaccttctg
ccatattttaccaaacattccggtaatctctttcccgagcaccggctttag

DBGET integrated database retrieval system