KEGG   Agrobacterium sp. H13-3: AGROH133_11685Help
Entry
AGROH133_11685    CDS       T01432                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
agr  Agrobacterium sp. H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AGROH133_11685
Enzymes [BR:agr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AGROH133_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADY66684
UniProt: F0LC74
Position
linear:complement(1049343..1050194)
Genome map
AA seq 283 aa AA seqDB search
MIFKAAAIQMRSGVDTVKNAADMERLVRVAAAAGAVYVQTPEMTGALQKDRQALRAQLRD
DDGDIIVATAARLARELGIHVHVGSTAIARPDGKIANRGFLFAPDGSRICSYDKIHMFDV
DLDNGESWRESAAYEPGAVARVAELPLGKFGFAICYDVRFPQLFRAEALAGAEVLTVPAA
FTRQTGEAHWEILLRARAIENGAFVIAAAQAGLHEDGRVTFGHSMIIDPWGKVLAMAGGA
GEEIIFAEIDTSLVAAARGKIPNLRNAREFGLDTVIPAGGEAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaggctgccgccattcagatgcgctcgggtgtcgatacggtgaaaaacgcc
gccgatatggagcgcctggtgcgtgttgctgcggctgcgggcgctgtctatgttcagacg
ccggaaatgaccggcgctctccagaaggacaggcaggcgcttcgcgcccagctgcgtgac
gacgatggcgatatcatcgttgcgaccgccgcgcggctggcacgcgaactcggcatccat
gtccatgtcggctcgacagcgattgcccgcccggatggcaagattgccaatcgcggtttt
ctgtttgcgcctgacggttcgcgtatctgcagctatgacaagatccatatgttcgatgtc
gatctcgacaatggcgaaagctggcgcgaaagtgcggcttacgaacccggcgctgtcgct
cgcgttgccgaactgccgctggggaaattcggctttgcgatctgctacgatgtgcgcttc
ccgcagcttttccgggcggaggcactcgccggcgccgaggttctgacggttccggccgcc
ttcacccgccagacgggtgaagcccactgggaaatcctgctgcgtgcccgcgccattgaa
aacggcgctttcgtcattgccgccgcacaggccggcctgcatgaggacgggcgggtcacg
ttcggccattccatgatcatcgacccctggggcaaggtgctggcaatggccggtggcgcc
ggggaagagatcattttcgcagagatcgacacgtctctcgtggctgccgcgcgcggaaaa
atccccaatctgcgcaatgcccgcgagttcggactggacacggttattcctgctggaggt
gaggcggcgtga

DBGET integrated database retrieval system