KEGG   Agrobacterium sp. H13-3: AGROH133_12989Help
Entry
AGROH133_12989    CDS       T01432                                 

Definition
(GenBank) hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00072  Synthesis and degradation of ketone bodies
agr00650  Butanoate metabolism
agr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AGROH133_12989
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AGROH133_12989
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AGROH133_12989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Eno-Rase_NADH_b Epimerase
Motif
Other DBs
NCBI-ProteinID: ADY67228
UniProt: F0LEF7
Position
linear:1635917..1636705
Genome map
AA seq 262 aa AA seqDB search
MMEDQPKTVLVTGSTSGIGLAIAKRFAEAGFLVAVHGIETVEAATQALEAVAKVARHRPV
YFSANLANYDESAHLPETVIAEFGHIDVLVNNAGIQKVAPIDEFDFADFSHIVAISLDSA
FHTIRAALPGMKERGWGRIVNIASAHGLRASPFKGPYVATKHAVVGLTKSVALEVAELGI
TCNAICPGYVWTPLVAAQVADQARLHGMGEDEVVKKVMLAPQPTRRFVQPEEVAEMALYL
TGDMARSITGTTISIDGGWTAK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggatcaaccgaaaaccgttctggtcaccggctccaccagcggcattggcctt
gccatcgccaaacgttttgccgaggcgggatttctcgtcgccgtccacggcatagaaacc
gtggaggcggcgacgcaggcactggaggcggttgcgaaggtagcgcggcaccggccggtc
tatttttctgccaacctcgccaattatgacgagagtgcacatctgccggaaaccgtcatc
gccgaattcggtcacatcgacgtgctcgtcaacaatgccggtatccagaaggtcgcgccg
atcgacgaattcgatttcgccgatttctcccatattgtcgcgatctccctcgacagtgct
tttcatacgatccgtgcagccctgccgggcatgaaggaaaggggttgggggcgcatcgtc
aatattgcttccgcgcatgggttgcgcgcctcacccttcaagggtccctatgtggcgacg
aaacatgccgtggtgggcctgacgaaaagcgtggcgctggaagtggccgaacttggcatt
acctgcaacgccatctgccccggttacgtctggacgccgctcgtcgcggcgcaggttgcc
gatcaggcgcgcctgcatggcatgggcgaggatgaggtggtgaagaaggtgatgcttgcg
ccgcagccgacgcgacgtttcgtgcagccggaggaagtggcggagatggcgctttacctc
accggcgatatggcacgctccatcaccggcaccaccatttccatcgatggcggctggacc
gctaaataa

DBGET integrated database retrieval system