KEGG   Agrobacterium sp. H13-3: AGROH133_14658Help
Entry
AGROH133_14658    CDS       T01432                                 

Definition
(GenBank) conjugal transfer coupling protein TraG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:agr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AGROH133_14658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_14658
Enzymes [BR:agr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     AGROH133_14658
Secretion system [BR:agr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   AGROH133_14658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind Acyl_transf_3 AAA_22 DUF4131
Motif
Other DBs
NCBI-ProteinID: ADY68024
UniProt: F0LG42
Position
pAspH13-3a:complement(286239..288158)
Genome map
AA seq 639 aa AA seqDB search
MKGKAKPRPSLLLIIIPIAVTGFSFYVAHWRWPELATGITGKTQYWFLRASPLPVLLFGP
LAGLLAVWALPLHRRRPVALASFLCFLLMAGFYGMREFGRLQPLVESGVLTWDQALSFVD
MIAVVGAAMGFMAAAVAARISSVVPEQVTRARRGTFGDADWLPMSAAARLFPDDGEIVIG
ERYRVDKELVHELPFDPNDPATWGRGGKAPLLTYSQDFDSTHMLFFAGSGGFKTTSNVVP
TALRYTGPLICLDPSTEVAPMVVDHRRDKLNREVVVLDPANPVMGFNVLDGIEHSLKKEE
DIVGIAHMLLSESLRFESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGRRNLRSLRQIVSE
PETSVLAMLRDVQEHSASAFIRETLGVFVNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GNAFKSSEIAGGKKDVFINISASILRSYPGIGRVIIGSLINAMIEADGAFTRRALFILDE
VDLLGYMRVLEEARDRGRKYGVSMMLMYQSVGQLERHFGKDGAVSWIDGCAFASYAAIKA
LDTARNVSAQCGEMTVEVKGSSRNLGWGTKNSASRKSESITFQRRPLIMPHEITQSMRKD
EQIIIVQGHSPIRCGRAIYFRRKDMDRHARPNRFAKLGP
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaaaggccaaacctcgtccaagcctcttgcttatcatcattcccatcgccgtc
accggtttttccttttacgtcgcccactggcgttggcctgaattggcgaccggcatcaca
ggcaagacgcaatactggttccttcgggcgtcaccgttgcccgtccttttgttcgggccg
ctggctggactgctggcggtctgggcgctgcccctccatcggcgaaggcccgtggcattg
gcaagctttctctgctttctcctgatggccggcttttacgggatgcgcgagttcgggcgg
cttcagccgctcgtagagagcggtgtgctgacctgggatcaggcgctatcattcgtcgac
atgattgcggtcgttggcgcagcgatgggattcatggcggccgcggtcgcggcgcgcatc
tccagcgtcgtgcccgaacaggtgacgcgcgccaggcgcggaacattcggagatgcagac
tggctgccgatgtcggcggcggcacggctgtttcccgatgatggcgaaatcgtcatcggc
gagcgctacagggtcgacaaggaactcgtccatgagttgccgttcgatccgaacgatccg
gccacctggggacgtggtggcaaagccccgctgctgacctactcccaggatttcgattcg
actcacatgcttttcttcgcgggctccggtggcttcaagaccaccagcaacgtcgtgccg
acggcgctcagatatacgggtccgctcatttgcctggatccgtccaccgaggtggccccg
atggtcgttgaccaccgaagagataaactcaaccgagaggttgttgtgctcgatccggca
aatccggtcatgggatttaacgtgctcgacggaatcgagcactcgctaaaaaaggaagag
gacattgtcggcattgcgcacatgttactctcggaaagcttgcgcttcgaatcgtcgact
ggctcttacttccaatcgcaggcgcacaatctgctgactggtcttctagcgcatgtgatg
ctgtcaccggaatatgcaggacggcgaaacctgcgcagcctgcgccagatcgtctccgag
ccggaaacctccgtgcttgccatgctgcgcgacgtacaggaacactccgcgtccgccttc
atccgcgaaacgctcggcgtctttgttaacatgaccgagcaaacattctcaggcgtctat
tcgacggcatcgaaggatacgcaatggctgtcgctcgataattacgcggcactggtttgc
ggcaacgcgttcaaatcgagcgagatcgctggcggaaagaaagacgtctttatcaatatc
tccgcatcgatcctgcggtcctatcccggtatcggtcgggtgatcatcggctcgctgatc
aacgcgatgatcgaagcggatggtgcgttcacgaggcgagcgttgttcattttggacgaa
gtcgatctgcttggctacatgcgcgtgcttgaagaggcgcgcgatcgcggtcgcaagtat
ggcgttagcatgatgctgatgtaccagtccgtcgggcaactggaacggcacttcggaaaa
gacggtgcggtgtcgtggatcgacggctgcgctttcgcgagttacgccgcgatcaaggca
ctggataccgcccgcaacgtctctgcccaatgtggagaaatgactgtcgaagtcaaaggc
agttctcgcaatctcggctggggtacgaaaaacagtgcgtcgcggaaatccgaaagcatc
actttccagcgccggccgctcattatgccgcacgaaatcacccaatcgatgcgcaaggac
gagcagatcatcatcgtccagggccacagtccgatccgctgcggacgggcgatctatttc
aggcggaaggacatggataggcacgccaggcccaacaggtttgccaagctgggaccttga

DBGET integrated database retrieval system