KEGG   Agrobacterium sp. H13-3: AGROH133_14805Help
Entry
AGROH133_14805    CDS       T01432                                 

Definition
(GenBank) type IV secretion protein AvhB8
  KO
K03203  type IV secretion system protein VirB8
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:agr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AGROH133_14805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agr02044]
    AGROH133_14805
Secretion system [BR:agr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   AGROH133_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ADY68100
UniProt: F0LGB8
Position
pAspH13-3a:354734..355405
Genome map
AA seq 223 aa AA seqDB search
MVTTDNLKSYFDKARRFDQDRMIQVERSNRIAWSIAIVSGIVAAVAVFAVACLTPLKTVE
PFVVRVDNSTGIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEAQENFRTIALL
STQAEQTRFAALYRGSNPQSPQNTYGRGATARIDIASISLINQNVVSVRYMRTITRGEEV
RTTHWVASITYSYANAPMSSTDRLVNPLGFVVSEYRADPEEVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgacagataatctcaagagctacttcgacaaagcacgtcgtttcgaccaggac
cggatgatccaggtcgagcgatcgaacaggattgcctggtcgatcgccatagtttcaggc
attgtcgccgctgtagccgtcttcgcggtcgcgtgtctcacacccctcaagacggttgaa
ccctttgtggtgcgcgtcgacaattcgaccggcattgtcgacgtcgtgtcagcgctgaca
tcgacggctggcacctacgatgaagcggtgacgaaatatttcgctgcaaaatatgtccgg
gcccgcgagggttacgtctggagtgaagcacaggaaaatttccgcaccatcgccctcttg
tcgacgcaagcggagcaaacgcgtttcgcggccctctaccgtggcagcaacccgcaatcg
ccccagaatacttatggtcgcggggctacagcaaggatcgatatcgcttcaatctccctc
atcaatcagaatgtcgtttccgtacgctacatgcgaaccatcacgcgtggcgaggaagta
cgaacgacccattgggttgcgtcgatcacctattcctacgcgaacgctccgatgtcctcc
acggaccggctcgtaaacccgctcggctttgtcgtcagcgagtatcgcgctgatccggag
gaggtgagatga

DBGET integrated database retrieval system