KEGG   Aphis gossypii (cotton aphid): 114119569Help
Entry
114119569         CDS       T05869                                 

Definition
(RefSeq) heat shock protein 70 A1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags03040  Spliceosome
ags04141  Protein processing in endoplasmic reticulum
ags04144  Endocytosis
ags04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ags00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114119569
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114119569
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114119569
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114119569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ags01009]
    114119569
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ags03041]
    114119569
   03009 Ribosome biogenesis [BR:ags03009]
    114119569
   03110 Chaperones and folding catalysts [BR:ags03110]
    114119569
   04131 Membrane trafficking [BR:ags04131]
    114119569
   03051 Proteasome [BR:ags03051]
    114119569
   03029 Mitochondrial biogenesis [BR:ags03029]
    114119569
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ags04147]
    114119569
Protein phosphatases and associated proteins [BR:ags01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114119569
Spliceosome [BR:ags03041]
 Complex B
  Other components
   Prp19 complex
    114119569
 Complex C
   Prp19-CDC5 complex
    114119569
Ribosome biogenesis [BR:ags03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114119569
Chaperones and folding catalysts [BR:ags03110]
 Heat shock proteins
  HSP70 / DNAK
   114119569
Membrane trafficking [BR:ags04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114119569
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114119569
Proteasome [BR:ags03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114119569
Mitochondrial biogenesis [BR:ags03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114119569
Exosome [BR:ags04147]
 Exosomal proteins
  Proteins found in most exosomes
   114119569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF3153 Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 114119569
NCBI-ProteinID: XP_027836957
Position
Unknown
AA seq 637 aa AA seqDB search
MVGKTAIGIDLGTTYSCVGVWQHGKVEVIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPVNTVFDAKRLIGRRFDDEKTQADIKHWPFKVVNDCGKPKIQVEFKGERKVFAPEEIS
SMVLTKMKETAEAYLGRNVTDAVITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAA
LAYGLDKNLKGERNVLIFDLGGGTFDVSVLQIDEGSIFEVKSTAGDTHLGGEDFDNRLVA
HLADEFKRKYKKDIRSNPRALRRLRTAAERAKRTLSSSSEATIEIDALMEGIDFYTRVSR
ARFEELCADLFRSTLQPVEKALADAKLDKGDIHDVVLVGGSTRIPKIQSLLQNFFCGKPL
NLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVTPLSLGIETAGGVMTKIVERNST
IPCKQTQTFTTYSDNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIEVTFD
LDANGILNVSAKENSSGRSKNIVIKNDKGRLSQAEIDRMLNEAERYKEEDERQKAKIAAK
NQLESYVFSVKQALDEAGDKLTESEKNKGKQECDAVVQWLDNNQLADKEEYEYKLKEIQK
SCSALMMKIHGAGQPGGAPPGAQGFPGSGGPTVEEVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggttggaaagacagcgatcggtatcgacttgggtaccacctattcttgtgtgggcgtc
tggcaacacggaaaagtagaggtcatcgccaacgatcaaggtaacaggaccaccccgagt
tatgtggcatttacagacaccgaacggttgatcggcgacgcggccaagaaccaggtggca
atgaatcccgtgaatactgtattcgacgccaagcgtttgatcggacgtcgtttcgacgac
gaaaagacacaagccgacatcaagcactggccgttcaaagtggtgaacgactgtggaaag
cctaaaatccaagtggaattcaaaggtgaacgtaaagtttttgcgccggaagaaatcagc
tcgatggttttgacgaaaatgaaggagaccgccgaagcgtacttgggccgtaacgtgacg
gatgctgtgatcacggtgccggcgtactttaacgattcgcagagacaggcgacaaaggac
gcgggcgtcatagctggtctgaacgtgatgcgaataatcaacgaaccgacagctgcggct
ttggcgtacggtctggacaagaacttgaaaggagagaggaacgttttgatatttgatctg
ggcggtggaacgttcgacgtgtccgttctgcagatcgacgagggttcgatatttgaagtt
aagtcaacggcaggcgacacgcacttgggcggcgaagacttcgacaaccggctggtagct
catttggccgacgagttcaagaggaaatacaaaaaagacatacgttccaatccgagagcg
ttgagacggttgaggactgccgccgaacgtgctaagagaacattgtcgtccagctcggag
gccaccatagagattgacgctctgatggaaggtatcgatttctacacacgagtttcccga
gcccgtttcgaggagttgtgcgcggatctgttcagatcgactctgcaaccggtggaaaag
gcgttggcagacgccaagttggataagggagacatacacgacgtggtgctcgtgggtggt
tcgacgaggatcccgaagattcagagtctcctacaaaactttttctgtggcaaaccgctc
aacctgtccataaatcccgatgaagctgtagcctacggcgccgcagtccaagcggcaata
ctgagcggcgacacgagttctgcgattcaagacgtattactcgtggacgtcacacccttg
tcgctgggcatcgaaaccgcgggtggagtgatgaccaaaatcgtcgagcgcaattctact
attccgtgcaaacaaacccaaacgttcacaacgtactcggacaaccaaccggccgtcacc
attcaagtgttcgaaggtgaaagggctatgactaaggataacaatctgttgggaacgttt
gacctgaccggcatacctccggcacctcggggtgtacccaagatcgaagtgacttttgat
ttggacgctaacggcattttgaacgtgtcagccaaggaaaacagttccgggcgctccaag
aacatcgtcattaagaacgacaaaggtcgtctatctcaagctgaaatcgatcgtatgctc
aatgaggccgaacggtataaagaagaggacgaacgccaaaaggctaaaatcgcggccaag
aaccagttggagagctacgtgttcagtgttaaacaagcgttagacgaggctggtgataag
ttgaccgagtctgaaaagaacaaaggcaaacaagaatgcgacgcggtcgtccagtggttg
gacaacaaccagttggcagacaaagaagagtacgagtataaactaaaggaaatccaaaag
agttgttctgcccttatgatgaagatacacggtgcaggacaacccggtggcgcgcctccc
ggtgcacaaggtttcccaggctctggaggacctactgtcgaagaagtcgattaa

DBGET integrated database retrieval system