KEGG   Aphis gossypii (cotton aphid): 114121911Help
Entry
114121911         CDS       T05869                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ags  Aphis gossypii (cotton aphid)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ags04131]
    114121911
Membrane trafficking [BR:ags04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    114121911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 114121911
NCBI-ProteinID: XP_027840219
Position
Unknown
AA seq 2417 aa AA seqDB search
MVSQMQRAFAQKLTNSNVNSSPRLSEDSASYNAHTIPTNNDQNTSTNTLIPTIVEPVDYE
NYIHQHHTCGGSIENDDPLMEFPDGSDDVDVYVLSRKVRSLIPAGPEEDISKLAPHVRDF
VRAYSRDWLVVDYVYRQTNTVEDDRSSLLAYEDSWIPSSRSSTYSRTSTNSASQRTQQRY
KNDRHNYSQQPKDLIKLNNKNSTSTNNSSSTENTLVSNNISGGSSSATDLINTANDPLIG
TVLQRLPIDTLDRLNAVARQENRQNRLFGSLPIKARQKTNSYIEYPTKPPVPREIVANRR
ILVKCLQLECSLDIETEPIYAHMSLYDVRRRKKMSENFYFDFNSSTTAGNEIDTTTRSRT
CVLDIDGTGSTSGDDLFLVIRLEKPLRGDSDSVISASDTTTFSNNEKSDMKSSSKSTQHH
HVKYRMPYAWTAVHLADVICCSGGSDSLDRNSSGSGSNSLDGRFGLSEFDRFRKKWATAG
GNSIDSNTVRRGSLDRRTSYSTTANNSGTLNTSNTADNRYSWSSDEFTTDAFRPVTLTVN
GFFKQETDKLKDDDLYKLLQDLKKPSSCPSKKLKNVNGSLKLDISPCPVDEVKQCLTPDL
IPLLSYDMASDDKIRPIREILEFPLASCRVSNPHYVYRNLLYVYPKELNFAGRTGSARNI
AVKVQLMCGERQPQDAAFAIFGKSSSPRYVCEAYTAVSYHQRCPSFYDEFKIKLPADLDD
RHHLLFTFYHVSCRRRGTLVGGQDNHQHRPQVAPETPIGYTWLPLLKDRCLNSGEICLPV
ALEPPPPANYSYITPDVALPGIEWVENHKGLFTVLLEPVSSIHPRDIHLNNFFNYCSVLE
RNPLPRRVAESNIEAELKHRISNLVRCQIDPLIEFVPVVLDKLLSLLVEMPVTQHQQPMN
LGQIIFRTLADLVSMTMSHSQGQQILSTYVRYQCCCCNVAAAAVANAKNNISESENDAFS
DGQEYSERLDKYFRLRSNSDPDTSKKPCSSPLLDGNTFAVFKNSGLDRACSMKTGRCQGG
IPPSQFEEQQNQQLYSDQKRLTSIKSVHEELALQWVVATSAVRRDAAANNSRFFFDVIIK
SMAVSLAMVPGGLDGDRKNRFSDQFFDDISTLCTSFALDIVSNYEKDSKQVNIINCNLAW
FLHDLLSLADRGFVFGLINTYVKTLFSKQQSLLTQLPHHESYSTLSSLKLDFLKIVCSHE
HYVPLNLINNNFHNLSPTFSVASTISSQSLSMASNNITVTESTVKEYSELTLGFRRHHYL
VGLVLSEFVTVLQCSKSDLKVKEKVVDLLLGLMSSHDTRYQQDRWSSRRKASSRVALMYL
PLLTAVTADSSFLNLLQLDFENSNDVVKNKLQNSESESDFDSYFVDGYKTPEKNTDENVN
AISASSLMGVKNTTASWYRQTSKNNCRKPKLNAVTSTKVLACILWVLKNLDNDVMQVWLA
ESSHQRAQNTLSILTLCINRFYNNSYNYKKGNHKCVNCNSQPSFTSTINSTQPAPSETYN
SNDSNNMSTTASSTSLSSTSQLSTTDDVKSRLEDVILGQGSARSELMRRKAGLDGGNSTT
GTTSKVRWRKDHVLTYNRPSSLQSCSCNVDCQLQLDKIFGTNQDQPDGELDLVNEIGFII
LDTIEQIIQVASLPAGLKNSNPNHWSIYRVFKLLLRAMSTITAIAATNNQQNTSNSSTSA
ASTTAALQCMFGTQRSMVAKFPEILFGDGLDESDLDINDDDKEVESYHFSTSSPSSNRCA
NLILMLLRHCAIKSSSIGVRAQAAASLYSLMRQNFDIENNFARVKMQITVALSTLIGGAG
ASSTAACESRKEGLFFNEEYLRRVLKTILLYAERDSVELQNTTFPDQVKDLVLNLHTILS
DTVQMKAYSQDPDMLMDLMYRVAKGYQQTSSPDLRLAWLENMARKHNQRNNFTEAAMCLI
HGAALVIEYLTTTENLDLIGCRGATCLECVSSNVLEECAVSDDVMVVSQAADQVCLGDEF
TEIGLVSLLDRAAELFQKAGMFEVMSQVYKVAIPLIEKTNDYKKLSDTYLKLHDAYGKLE
KLQGRRVFGTYFRVGFYGAKFFGSDGLDGEEFVYKEPTLTKLSEIFGRLQNFYSERFGED
CVTIIKDSNTVDVSALDPRKAYIQITYVEPYFDAYERRMRATHFQRNFNLKRFVFFTPFT
PDGRAHGQLNQQYKRKTILTVAHHFPYLKTRIRVQSRQTIVMGPIEVALEDLKKKTDELA
RSVRQHPADPKMLQMVLQGCIGTTVNRGPMEMATVFLAPPQYDKNTNNRSPEVSDECSIQ
PPPPRLQNKLRLCFKDFSKKCADALAKNKTLIGPDQRDYQRELERNYRRFTDQLAPLLIA
ATSSHFDSGDSGYNNSTNTHGPYGLHHNGGCNSNAQTYDNDDNQDEEDDTTITNISNGGN
EIIMTNNINGDSTYTIL
NT seq 7254 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctcaaatgcaacgagcatttgctcaaaaacttaccaatagcaatgtcaactca
tctcctagattgtcagaagattcggcatcttataatgcccatacaattccaacaaataat
gatcaaaatacttctaccaacactctcatacctacgattgtggagcctgtggattatgaa
aactatattcaccaacatcacacttgtggtggtagtattgagaatgatgatcctttaatg
gaatttcctgatgggtcagacgatgttgatgtttatgtcttgtcacgtaaagtgcgttca
ttgatacctgcaggccctgaagaagatatctctaaactagcacctcatgtacgtgatttt
gtcagagcttacagtcgagattggctcgttgttgattatgtgtatagacaaacaaatact
gttgaagatgatagatcaagcttattagcttatgaagattcttggattccttcatctcga
agtagtacttatagtaggacttcaacaaattctgcatctcagcgtactcaacaacgttat
aaaaatgatcgtcacaactattcccaacagcctaaagatttaataaaacttaataataaa
aattcaacttctacaaacaatagttcaagtactgaaaatacactggtatcaaataatatc
agtggtggttcatcatcggctacagatctgatcaacacagctaatgatccattaattgga
actgtattgcagagattgcccatcgatacacttgataggttaaatgcagtggcacgacaa
gaaaatagacaaaaccgattatttggctcattacctattaaagcaaggcaaaaaaccaat
agttatatcgaatatccaactaaaccacctgtacctcgtgaaattgttgctaaccgtcga
attctagtcaaatgtctacaacttgagtgctctttagacatagaaactgaacctatttat
gctcatatgtcattatatgatgttcgacgtcgtaaaaaaatgtcagaaaatttttatttt
gattttaactcatctactactgctggtaatgaaattgatacaactacacggagtcgtaca
tgtgtacttgatatagatggtacaggatccacatctggagatgatttatttttagtcata
agactggaaaaaccgttacgtggagattctgactctgttatatctgcttctgatacaaca
acattttccaataatgaaaagagtgatatgaaatcaagtagtaaatcaactcaacaccat
catgttaagtatcgtatgccatatgcttggactgctgttcatttggcagatgtaatttgc
tgttctggtggttcagacagcctcgatcgtaatagttcaggaagtggatcaaatagttta
gatggtaggtttggacttagtgaatttgatcgatttcgtaaaaaatgggctacagctggt
ggaaatagtatagattctaatactgttcgccgagggtcattagatcgcagaactagttac
tcaacaacagctaacaacagtggtaccctaaatacttcgaatactgctgataatcgatac
agttggtcttctgatgaatttactactgatgcattccgtccagttacactcactgttaat
ggatttttcaaacaagaaactgataaacttaaagatgatgatttgtataaattattacaa
gatttaaaaaaaccatcaagttgtccatcaaaaaaattaaaaaatgttaatggttctttg
aaattagacatatcgccttgtccagttgatgaagttaaacagtgtttaactccagaccta
ataccattattatcatatgatatggcctctgatgataaaattcgaccaattagagaaata
ttggagtttccattggcaagttgccgcgtttcaaatcctcactatgtttatcgtaatttg
ctttatgtttaccccaaagaattaaactttgcaggaagaacaggttctgctagaaatatt
gctgttaaagttcaattaatgtgtggtgaaagacaaccacaagatgcagcatttgctata
tttggaaaatcatcaagtcctcgttatgtatgtgaagcatatacagcagttagctaccac
caacgttgtccatctttttatgatgaatttaaaataaaattaccagctgatttagatgac
cgccatcatttattatttacattttatcatgtaagctgtcgtcgccgtggaactcttgtt
ggtggtcaagataatcatcagcatcgaccacaagttgcaccagaaacaccaattggatat
acatggttacctctattaaaagatagatgtttaaattctggagaaatatgtttacctgtt
gcattagaaccaccaccacctgcaaattattcttatattacacctgatgtggcattacct
ggaattgaatgggtagaaaatcataaaggcttattcacagtacttttggaaccagtgtca
tccattcatcctagggatattcatttaaataattttttcaactactgctctgtattagaa
cgtaacccattaccaagacgagttgctgaatcaaatattgaagctgaactaaaacacaga
atttcaaatttggttcgctgtcaaatcgatccacttatagaatttgtaccagtagtgctt
gataaattgctttccttattagtagagatgcctgttactcagcatcaacaacctatgaat
ttggggcaaataatatttcgtactctagctgatttggtttcaatgacaatgagtcattca
caaggtcagcaaatattatccacttatgtgcgttatcagtgctgctgttgtaatgtagcc
gcagcagcagtagcaaacgccaaaaataatataagtgaaagtgaaaatgatgctttttct
gatggacaagagtattcagaaaggcttgataaatattttcgtttaagaagtaacagtgat
ccagacacatcaaaaaaaccttgctcttcgcctcttttggatggcaatacctttgctgta
tttaaaaatagtggactggacagagcgtgcagtatgaaaactggtcgctgtcaagggggt
attccaccatcacaatttgaagagcaacaaaatcagcaattgtattctgatcaaaagagg
ttgacttccatcaaaagtgtacacgaagaattagctttacaatgggtggtagccactagt
gcagtacgtcgggatgctgcagctaacaattcaagatttttttttgatgttataattaaa
agcatggctgtttcattagcaatggtgcctggaggattagatggtgatcgcaaaaaccgt
tttagtgatcaattttttgatgatatatcaacattatgcacaagttttgctttagatatt
gtatccaattacgaaaaagactcaaagcaggtgaacataattaattgtaatttagcatgg
tttttgcatgatttgctatctttagctgacagaggatttgtatttggcctgataaataca
tatgtgaaaacattattttcaaaacagcaaagtcttcttacccaattgccacatcatgaa
agctactccactttgtctagtctaaaattggactttttaaaaatagtttgtagccatgaa
cattacgtgccattaaatttgattaataataattttcataatctctcacctacattttct
gtggcatctacaatttcaagtcagtcattgtcaatggccagtaataatataactgtcaca
gaatccacagtaaaagaatactcggaattaacattaggatttcgacgtcatcattatttg
gttgggctagtattatcagagtttgtcacagtgttacaatgttctaaaagtgatttaaaa
gtaaaagaaaaagtggttgatttattattgggtctcatgtcttcacatgatactcgttat
caacaagataggtggtcgtctagacgcaaagcatcatcaagagttgctctcatgtatctg
ccattgttaacagctgtaactgcagattcatcatttctcaatttattacagttagatttt
gaaaatagtaatgatgtagttaaaaataaacttcaaaacagtgaaagcgaaagtgatttt
gattcatattttgttgatggttataaaactccagaaaaaaatactgatgaaaatgtaaat
gcaatttcggcgtcatcattaatgggtgtaaaaaataccacggcgtcttggtacagacaa
acaagtaaaaataattgtcgtaagcctaagttgaacgcagttacatccaccaaagttcta
gcttgcatattatgggtattgaaaaatctagataatgatgtaatgcaagtgtggttagct
gagtcatctcatcaaagggctcaaaatacattgtcgattttgacattatgtattaaccgt
ttttacaataattcttacaactacaaaaagggcaaccataaatgtgttaattgtaattct
caaccatcatttacatcaacaattaattctactcaaccggctcctagtgagacatataat
agtaatgatagtaataatatgtcaacaacagcttcatccacatcattatcatctacatct
caactgtcaactactgatgatgtaaaatcaagacttgaagatgttatattaggtcaagga
tcagctagatcagagttgatgcgtcggaaagctggacttgatggtggcaatagtactact
ggcactactagtaaagtgagatggagaaaagatcatgttttaacatataatagaccttca
tcattgcaatcttgttcctgtaatgtggattgtcaactacaacttgataagatatttggt
accaatcaagatcaacctgatggagaattagatttagtaaacgaaattggttttataata
cttgataccattgaacaaatcattcaggtagcttctctgcctgccggcttaaaaaattca
aatcctaaccattggtcgatatatcgtgttttcaaactacttcttcgagctatgtctacc
atcactgctattgctgctactaataatcaacaaaacactagtaatagttctactagcgca
gcatcaacgacggctgcattacaatgcatgtttggtacacagagatcaatggttgcaaag
tttccagaaattttatttggagatggtctagacgaaagcgatttagatatcaatgacgat
gataaagaagtcgaaagttaccacttttctaccagcagtccatcatccaatcgttgtgct
aatcttatattgatgctgttacgccattgtgcaataaaatcaagttcaataggagtccga
gcacaagcagctgcttcgttatactcattgatgcgtcaaaactttgacatcgaaaataat
ttcgctcgtgtgaaaatgcaaataactgtggcattaagtacattaataggaggagctgga
gcatcatcaacagctgcttgtgaaagtagaaaagaagggttatttttcaatgaggagtat
ttaagacgggttttgaagacaatactgttatatgctgaacgggattctgttgaattgcaa
aacactacattccctgaccaggtaaaagatctggtattgaacttgcatacaatactttcg
gatacggttcaaatgaaagcatatagtcaagatccagacatgttaatggatttgatgtac
cgcgtagctaaggggtatcagcagacatcatcaccagatctccggcttgcatggcttgaa
aatatggctcgaaaacataatcagagaaataattttactgaagcagctatgtgcttaatt
cacggagctgcattagtcattgagtatctgactacaacagagaaccttgatttaattgga
tgtagaggggccacatgtctagagtgtgtatcgtctaatgtgttagaagaatgtgcggtt
tcagatgacgtgatggttgtcagtcaagcggctgatcaagtttgtttgggtgacgaattc
accgaaattggacttgtgtcattattagatagagcagcagaactattccaaaaggccggt
atgtttgaagtcatgagtcaggtgtacaaagtagcaatacctttaattgaaaaaaccaat
gattataaaaagctatcggatacatatttgaaattacacgatgcgtacggtaaattagaa
aagttacagggtcgtcgggtatttgggacgtattttcgtgttggattttatggagccaag
ttttttggatctgatggattggatggcgaggaatttgtttacaaagaacctacactcact
aaactttcagagatatttggacgtttacaaaatttttattctgaacgatttggtgaagat
tgtgtgactattatcaaagattctaacacggtagatgtaagtgcattagatccaaggaaa
gcatacatacaaatcacatatgtagaaccgtactttgatgcgtatgaacggcgtatgcgt
gccacacatttccaaagaaattttaacttgaaacgctttgtgtttttcacaccttttact
cccgacggtcgggcacatggacaactaaatcaacaatataaacgtaagactattttgact
gttgcgcatcattttccttatttaaaaacccgaattcgcgtacaaagtcgtcaaacaatt
gttatgggacccatagaagtggctttagaagacttaaaaaagaaaactgacgaattagca
cgaagtgtccgtcagcatccggctgatccaaaaatgttacaaatggtcctccaagggtgt
ataggtactactgtaaatcgagggcctatggaaatggctacagtgtttttagcaccacca
caatatgataaaaataccaataataggagtccagaagtttccgatgaatgttctatacaa
ccgcctccgccacgactacaaaacaaattacgactatgttttaaagatttttccaaaaag
tgtgctgatgctttagcgaaaaacaaaactcttattggtcccgatcaacgagattatcaa
cgtgaacttgaacgtaattaccgtagatttactgatcagttagctccacttctgatagct
gcgacttcgtcccattttgatagtggtgattctggttacaataattcaacaaacacacat
ggaccttatggccttcatcataatggtggatgtaatagtaatgctcagacatatgacaat
gatgataaccaagacgaagaagatgatacaacaataacaaacattagtaatggggggaat
gaaataattatgactaacaatattaacggtgattccacgtatacaatattgtaa

DBGET integrated database retrieval system