KEGG   Aphis gossypii (cotton aphid): 114122083Help
Entry
114122083         CDS       T05869                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags03040  Spliceosome
ags04141  Protein processing in endoplasmic reticulum
ags04144  Endocytosis
ags04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ags00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114122083
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114122083
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114122083
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114122083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ags01009]
    114122083
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ags03041]
    114122083
   03009 Ribosome biogenesis [BR:ags03009]
    114122083
   03110 Chaperones and folding catalysts [BR:ags03110]
    114122083
   04131 Membrane trafficking [BR:ags04131]
    114122083
   03051 Proteasome [BR:ags03051]
    114122083
   03029 Mitochondrial biogenesis [BR:ags03029]
    114122083
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ags04147]
    114122083
Protein phosphatases and associated proteins [BR:ags01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114122083
Spliceosome [BR:ags03041]
 Complex B
  Other components
   Prp19 complex
    114122083
 Complex C
   Prp19-CDC5 complex
    114122083
Ribosome biogenesis [BR:ags03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114122083
Chaperones and folding catalysts [BR:ags03110]
 Heat shock proteins
  HSP70 / DNAK
   114122083
Membrane trafficking [BR:ags04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114122083
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114122083
Proteasome [BR:ags03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114122083
Mitochondrial biogenesis [BR:ags03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114122083
Exosome [BR:ags04147]
 Exosomal proteins
  Proteins found in most exosomes
   114122083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464 SHS2_FTSA
Motif
Other DBs
NCBI-GeneID: 114122083
NCBI-ProteinID: XP_027840439
Position
Unknown
AA seq 538 aa AA seqDB search
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVMRIINEPTAAAI
AYGLDKKTSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF
VQEFKRKYNKDVTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITRAR
FEELNADLFRSTMEPVEKSLRDAKMDKSAINDIVLVGGSTRIPKVQKLLQDFFNGKELNK
SINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIP
TKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTAIPPAPRGVPQIEVTFDID
ANGILNVSAIEKSTNKENKITITNDKGRLSKEDIERMVNDAEKYKNEDEQQKNVIAAKNG
LESYCFNMKSTMEDEKIKDKIPDTDKTVILDKVNDTINWLDANQLADKEEYEHKQKELEA
ICNPIITKLYAGAGAGAGGMPGGMPGGFPGGMPGGFPGGDGGAGAAGAGAGPTIEEVD
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaccaagatgaaggaaaccgctgaagcctacttgggaaaaactgtatcaaac
gcagttatcactgtacctgcatatttcaacgattcccaacgtcaagctaccaaagattct
ggtaccattgctggtttgaacgtaatgcgtatcatcaatgaacctactgccgctgccatt
gcatacggtcttgacaagaagacatctggagaacgcaacgttctgatcttcgatttgggt
ggtggtacttttgatgtttccatcttgaccatcgaagatggaatattcgaagtcaagtcc
actgctggagacactcacttgggaggtgaagattttgacaacagaatggtcaaccacttt
gtacaagagttcaaacgcaagtacaataaggacgtgaccaccaacaaaagagccttgaga
cgtttgaggactgcctgtgaacgtgcaaagcgtactctttcctcttccacccaagcaagc
attgaaattgattcgttgtttgaaggtgtcgacttctacacatccatcactcgtgctcgt
tttgaagaattgaacgccgatcttttccgtagtaccatggaacccgtagaaaaatctcta
cgtgacgctaagatggacaagtctgccatcaatgacattgtattggttggaggttctacc
cgtatccccaaagtacagaaattgttacaagacttcttcaacggcaaggaattgaacaaa
tccatcaatcccgatgaagctgttgcctatggtgccgcagtacaagctgccatcttgcac
ggagacaaatctgaagaagtccaagacttgttgttgctcgatgtcactcctctgtctttg
ggtattgaaactgctggtggtgtgatgaccgctctcatcaagcgtaacacaaccattccg
accaaacagacccagactttcaccacctactctgacaaccaacccggagtcttgatccaa
gtttatgaaggagaacgtgccatgaccaaagacaacaacttgttgggaaaattcgaattg
actgctattccccctgcaccacgtggagtcccccagatcgaagtcaccttcgacatcgat
gctaatggtattttgaacgtcagtgctattgaaaagtctaccaacaaagaaaacaagatc
accatcaccaacgacaagggacgtttgagcaaggaagatatcgagcgcatggttaatgac
gccgaaaaatacaagaatgaagatgaacaacaaaagaatgtaattgctgccaagaacggt
ttggaatcttattgtttcaacatgaagagcacaatggaagatgaaaaaatcaaggacaag
atcccagataccgataaaactgtaattcttgataaagtcaatgatactatcaattggttg
gatgctaaccaactagctgacaaggaagaatatgaacacaagcaaaaagaattggaagcc
atttgcaacccaattatcactaaattgtatgctggcgctggtgctggtgccggtggcatg
cctggaggtatgccaggaggtttccctggtggtatgccaggtggtttccctggtggtgat
ggtggtgctggagctgctggtgcaggcgctggcccaactattgaagaagtcgattaa

DBGET integrated database retrieval system