KEGG   Aphis gossypii (cotton aphid): 114122813Help
Entry
114122813         CDS       T05869                                 

Definition
(RefSeq) receptor-type guanylate cyclase Gyc76C-like isoform X1
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00230  Purine metabolism
ags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114122813
Enzymes [BR:ags01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114122813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA ETRAMP
Motif
Other DBs
NCBI-GeneID: 114122813
NCBI-ProteinID: XP_027841381
Position
Unknown
AA seq 1347 aa AA seqDB search
MLNGRPKAAVLILLLALFVLTGPPGTLADNTGSSSSAAAVANTTDAYTSSTNTTTALTAD
NITTTASAAPSTILRNLTIGYLTAARGKLDNRQGLSISGALTLALEEIEDDPHLLPNVSL
MLKWEDTHGETVHATKTITQMICDKVAVFFGPEGNTCYTEAIVAQAWNIPMISYKCADYK
ASQVPTFARTEPPDTQITKSIISLLRYYNWKKFSIITEEPWKNVAESLKIQALQANMTIN
HFMTIVDPHQCCEQDQSCCNVGHWYSVVQETMVNTRIYVFLGVAKSLVDMMNTMHALQLF
DNGDYMVIFADTKINTWKDSQQYLWRQRDSFDMSNCMEEKNFLKRARSLLVIVASPPSPE
KYGVFTNKVSEYTSKEPFKFPTPTVFKNASYVKFVSIYAAYLYDSVMLYARTLDLLLRDK
ANGRELTGEMIDEVAYNGTLIIETLVKNITYQSITGATIKLDINGDSEGNYSVVALKSHD
FQYHLNEGNFSCPYYMIPVAQFYHGELLEYKLNSPNLKIEWPGKSRPDDEPSCGFNNELC
KKNDMEKSSIIVATVLGLTLFCAFVITLSIYRKWKIELEIEGLLWKIDPSDLLGYYNKDI
VSSPSKLSLVSATSYESRCGLQVFATTGHYRNITVRIKELKFSKRKDISREQMKEMRLLR
DLKHSNVNSFIGATIEPLRILIVTDYCAKGSLYDIIENEDIKLDKMFITSLVHDLIRGMI
FIHNSPLGCHGNLKSSNCIVTSRWVLQVTDFGLHDLRQGAENDSIGEHEYYRNLLWKAPE
LLRDSNASVKGTQKADVYAFSIILHEIMCRRGPFGACGVEEPKEIIRLVMLGYDEVNGVP
LRPSIHHLRDCEMAEDYVIQCITDCWDESPENRPDFGMIRARLKKMKDGKHKNIMDQMMD
MMEKYANNLEDIVNQRTHEVYEEKQKTEDLLHRMLPAPVAKQLTLGHGIEPESYNSVTIY
FSDIVGFTAMSAESTPLQVVNFLNDLYTLFDKIIKGYDVYKVETIGDAYMVVSGLPIRNG
NRNSGEIASMSLNLLEAVKHHKIAHHPEATLKLRIGIHTGPVVAGVVGLTMPRYCLFGDT
VNTASRMESNGEPLKIHISQQCKNALDELGGYIIKERGYVNMKGKGDVLTYWLEGTTEKA
IKRRDVDLTESPPLFCGSKRHSPKLYNFGEHGSRRPSFAPRGNSFDQNAKDSQTILHEQR
PTPLPYPLLEPRRKQMIHSTSMDPFPNKHISRVSSMIKRSCRSLEDSKLLNDQCTKEEHC
EENVDETVVNGSLQYTPLLSIEDNKRWHSFEDISMEPHRKKLVSRNSIRSWLVGLFNGTA
TSCRTSEVSLRKTYSDRQQIVDKESVV
NT seq 4044 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacggtcgaccgaaggcggcggtcctaatcttgttgcttgcgttgttcgttctc
accggacctcctgggacgctggcggataacaccggcagctcgtcgtccgcagccgccgtc
gccaacaccacagacgcctacacctcatctaccaataccaccaccgccctgacagccgac
aacatcaccaccaccgcctcggcagctcccagtactatattacggaatctgacgatcggc
tatctgaccgcggccagggggaaattggacaaccgacaaggcctgtcaatttcaggagcc
ttaactttggcgctcgaggagatcgaggatgatccgcacctgttgcccaatgtgtcgctg
atgttgaaatgggaggacacgcatggcgaaacagtgcacgcgaccaaaacgatcacgcag
atgatatgcgacaaggtggccgtgtttttcggacccgagggcaatacgtgttatactgag
gcaatagtcgcgcaggcgtggaacattccaatgattagctataaatgtgccgattacaaa
gcatcgcaagtaccgacgtttgctcgaactgaacctccggacactcaaatcaccaaatcg
attatatccttgctaaggtattacaactggaagaagttcagcataatcacagaagaaccc
tggaagaacgtagccgagtctttgaaaatccaagcgttacaagccaacatgaccataaac
catttcatgacgattgtcgatccgcaccaatgctgtgaacaagatcagtcgtgctgcaac
gtaggacattggtactcagtagtacaagaaactatggtcaataccagaatttacgtattt
ttgggcgttgctaaatcactggtggacatgatgaacacaatgcatgccttacagctattc
gacaacggtgattacatggtcatttttgcggatactaagatcaacacttggaaagactct
caacaatatttgtggagacaacgtgattcattcgatatgtcgaattgtatggaagagaaa
aattttctcaagcgtgcccgttcgttgttggttattgttgcctctccaccgtcacctgaa
aaatatggagttttcacaaataaagtttcagaatacaccagcaaagaaccgtttaaattt
ccaaccccaaccgtgtttaaaaacgcatcatatgtcaagtttgtgtccatttatgctgcc
tatttgtacgattcggttatgttatatgcacgaacattagatcttttgcttagagataaa
gcaaacggtcgggaattaacaggtgaaatgatcgatgaagtagcttataatggaacactt
atcattgagacacttgttaagaatataacataccagagcattactggtgcaacaatcaaa
ttagacattaatggtgattcggaaggaaactattcggtggtagctttgaagtcgcacgat
tttcaataccatttgaatgaaggaaatttctcttgcccgtattacatgattcctgtggct
caattctaccacggtgaattactggagtacaaattgaactctcctaatttaaaaattgaa
tggcccggtaaaagtcgaccagacgatgaaccgagttgtggcttcaacaatgagttgtgc
aaaaaaaatgacatggaaaaaagctccattatagtcgctacagttttggggctaacttta
ttctgtgcatttgttatcaccctgtctatatatagaaaatggaaaatagaattagaaatt
gaaggactattgtggaaaatagacccatcagatctgcttggatattacaataaagatatt
gtttcatctccaagcaaattgagtttggtttcggctacctcatatgaatcccgttgtgga
cttcaagtttttgcaacgactggtcattatcgtaacataacagttagaattaaagaatta
aaattttcaaagcgcaaagacatttctagagaacaaatgaaagaaatgagattattgaga
gatttaaagcacagcaacgtgaactcttttatcggtgctactattgaaccattacgaata
cttatagttaccgattattgtgctaaaggaagtctctatgatataatagaaaatgaagat
attaaactagacaaaatgtttatcacatctttagttcacgatctcatcagaggtatgata
tttatacacaactcgcctttaggttgtcatgggaacttaaaatcatctaattgtattgta
actagtcgttgggtattgcaagtcactgattttggtctacatgatttgaggcaaggcgcg
gaaaacgactctattggtgaacatgagtattatagaaatttattatggaaagctccagag
ctattaagagactctaatgcatccgtaaagggaacacaaaaagcggatgtatacgctttt
tctattatcttgcatgaaataatgtgtcgacgaggtccttttggtgcttgcggcgtcgaa
gaacctaaagaaattataagactggttatgttaggttatgatgaagtaaatggtgtgcca
ctgaggcctagtatacatcatttgagagactgtgaaatggcagaagactatgtcatccaa
tgcattaccgattgttgggatgaatcaccagaaaatagaccagactttggcatgatacgt
gccagacttaaaaaaatgaaagatggaaaacataaaaatataatggatcaaatgatggac
atgatggaaaaatacgcaaacaatcttgaagatatagtcaatcaacgtacacatgaagtg
tatgaagaaaaacaaaaaactgaagatttattacataggatgcttccagcgccagtagca
aaacaattaactctaggacacggtattgaaccagaatcatacaattcagttaccatttac
tttagtgatattgttggttttactgcaatgtctgctgagagtactcctttacaggttgta
aattttttaaacgatctttacacattatttgacaaaatcattaaaggctacgatgtttac
aaagttgaaacaataggagacgcttacatggtggtgtcagggttgcctattagaaatggt
aatagaaattccggtgaaatagcttcgatgtcattaaatttacttgaagccgtaaaacat
cacaaaattgcacatcacccagaagctacgttaaaattacgtataggaattcacacagga
cctgtagtcgctggtgtagttggtcttacaatgcctaggtattgtctgtttggtgatact
gtaaatacagcttcacgaatggaatctaatggtgaacctttaaaaattcacataagtcaa
caatgtaaaaatgctcttgatgaactaggaggttatataatcaaagaacgtggatatgtt
aacatgaaaggaaaaggagatgtactcacttattggcttgaagggacaactgaaaaggct
atcaaaagaagagatgtggatttgactgaatcacctcctctgttttgtggatcaaaacgc
cacagtccgaaattatacaactttggagaacacggcagtagacggccatcatttgctcca
cgaggaaattcatttgatcaaaatgccaaggacagtcagactatactccacgaacagaga
ccaactcctttaccttatcctctgcttgaaccacgacgtaaacaaatgatacattctacg
tctatggatccatttcctaacaaacacattagcagagtgagctcaatgatcaaaagaagt
tgtcgttcattagaggattcaaaacttcttaatgatcaatgcacaaaagaagagcactgt
gaagaaaatgtcgatgaaactgtagttaatgggagccttcaatacacccctttattgtca
atagaagacaataaacgatggcattctttcgaagacatttccatggaaccgcatagaaaa
aaattggtttcaagaaattcaattaggagttggttggttggattattcaatggcactgct
acatcttgtcgaactagcgaagtatcattacgtaaaacgtattcagacaggcaacagatt
gttgacaaggagagtgtagtttaa

DBGET integrated database retrieval system