KEGG   Aphis gossypii (cotton aphid): 114124124Help
Entry
114124124         CDS       T05869                                 

Definition
(RefSeq) myotubularin-related protein 3 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00562  Inositol phosphate metabolism
ags01100  Metabolic pathways
ags04070  Phosphatidylinositol signaling system
ags04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114124124
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    114124124
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114124124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ags01009]
    114124124
Enzymes [BR:ags01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     114124124
    3.1.3.64  phosphatidylinositol-3-phosphatase
     114124124
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     114124124
Protein phosphatases and associated proteins [BR:ags01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    114124124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE FYVE_2 Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 114124124
NCBI-ProteinID: XP_027843142
Position
Unknown
AA seq 846 aa AA seqDB search
MELSDSSGSSSTVTQSMCHVRASELYPKRDLETDESPPTLEPPLVPFVPLAGESVEYLGR
GANNTVLALSNYRFYLKVSNEGSKRRRGIQDSNIPLGLIEMIEIKDLFYIIISCKDSRTC
RCTFTTNDLCLEWYKRLTRVIVSPKNVQDVFAFAFHAWAIEDQCNEDISSNLGHDGDDDY
FMKEIERLNISVLSDNSKWRISKVNWDYKLCTSYPNRLLVPSCITDQTLEAAAKFRSSKR
VPVIVWRHKGNGAILARCSQPEVGWLGWRSSEDEDLLKAIAESCQNKSKKPKKLVVIDAR
SYPSAVANRARGGGCECPEYYPGCEIRFMNLANIHAVRKSFHLLRQLCASPPDLPNWYSL
LENTRWLHNISGLLHAANTVAATIEFEMQPVLVHCSDGWDRTPQIVSLAELMLDSYYRTI
DGFRVLCQREWLDFGHKFADRGQGEDPNERCPVFIQWLDCVHNVMSQYPCAFEFSKTYLV
KLAQHTYSNLFGTFLCNSGAERKRTGIGTATFSVWKHLAASAECKNHLYSSQSDNVLWIS
CNVRDMNLWRDLYVGPFTDGPQLTKTTEICNPIMGMDGIIDPIIRIDQPIVISSEDPCLE
FSKPEDIISLDERDDKSSDTNSSSLSSIIAEENGIERHSSPTNCILNTVDGLLPLVDDVQ
NRLQQLNLEHKTREAALQNELHVTRLVLLRQASHRCNGIETTPTPDVNGLSLADKTDDDV
SVCSSTGGETTLSWEPVESFDAQPTLWVPDHAVTQCMSCDNKFWLGRRKHHCRSCGKIFC
ADCSRNLVPLPAEQLYEPVRVCEPCFSVGALKTTSTSTTTTTITCKQAVADDQKNVNITL
QPAPSN
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggagttatctgattcatctggcagttcatcaactgtgactcagtctatgtgtcatgta
cgagcctctgaattgtatccaaaaagagatttggagaccgatgagagtcctccaacttta
gaaccaccattggtgccttttgttcctttagctggtgaatctgttgaatacttaggtcgc
ggtgccaataacactgtattagcactgtccaattaccgtttttacctaaaagtatctaat
gaagggtcaaaacgaagaagaggcattcaagacagcaacataccattgggccttattgaa
atgattgaaataaaagatctattttacataataattagctgcaaagattctcggacatgc
aggtgtacttttactacaaatgatttatgtttggagtggtataagcgattgaccagagta
atagtatcacctaaaaacgttcaagatgttttcgcgtttgcatttcatgcttgggcaatt
gaagatcaatgtaatgaagatatttcttctaacttaggtcatgatggtgatgatgattat
tttatgaaagagattgaaagactaaatataagtgttctaagtgataactctaaatggcgt
atttctaaggtaaattgggactataaattatgtacctcttatccaaatcgattattggtt
ccttcttgtattactgatcaaactttggaagctgctgccaaattccgtagttccaaacga
gttccagtaatcgtatggagacataagggtaatggagctattttagcaagatgttcccaa
cctgaagtgggttggttagggtggagatcctctgaagatgaagacttattgaaagcaatt
gctgaatcttgccaaaataaatctaaaaaacctaaaaaattagttgtaattgatgcacga
tcatatccgtctgctgtggctaatcgagctagaggtggaggatgtgaatgtcccgaatat
tatcctgggtgtgaaattcgattcatgaatttggcaaatattcatgcagtgagaaaaagt
tttcacttacttcgtcaactatgtgcttcacctcctgatcttccaaactggtacagttta
ttggaaaacacacgatggttacataatataagtggtctccttcatgctgctaatactgtt
gcggcaactattgaatttgaaatgcaaccagttcttgttcattgctcagatggttgggat
cgaactcctcaaattgtctctttggctgaactaatgttggattcttattatcgaacaatt
gatggttttcgtgttttatgtcagagagaatggttagattttggacataaatttgctgac
cgtggtcaaggtgaagatccgaatgaacgatgtccagtatttattcaatggttggactgt
gtgcataatgtaatgtcacagtatccttgtgcttttgaattttccaaaacctacttagtc
aaattagcacaacacacatactcaaatctttttggtacatttttgtgcaatagtggtgcc
gaaagaaaacgcacagggataggtactgctacattttctgtttggaaacatttggctgca
tctgctgagtgtaaaaatcatttatattcatctcaatcggacaatgttttatggatcagt
tgtaatgtgagagatatgaatctttggagagatttatatgttggaccatttactgatggg
cctcaactaacaaaaactactgaaatatgtaatcctataatgggtatggatggcataatt
gatccaataataagaattgatcagcctattgtgataagcagtgaagatccatgcttagag
ttctcaaaaccggaagatataatatctttagacgaaagagatgataaatcttcagatacc
aattctagttcattgtcaagtattattgctgaggaaaatggtatagaacgacattcaagt
ccaactaattgtatcttaaatactgttgatggactgttaccacttgtagatgatgtacaa
aatagactacagcagttaaatttagaacataagacgagagaagcagctcttcaaaatgaa
ttacatgtcactcggctagtactgttgcggcaagcaagccatcgttgtaacggtattgaa
acaacacctacgcctgatgtgaatggtctatcactagcagacaaaactgatgatgatgta
tccgtgtgtagcagcacaggaggagagacgacattgtcgtgggaacctgtggagtcgttc
gatgctcaaccaaccctgtgggtgccggatcacgcggttacccagtgtatgtcgtgcgac
aacaagttctggctgggaagacggaagcatcattgtagaagttgcggtaaaatattctgt
gccgactgttcacgaaatctggttcctctgccagctgaacaactttatgaacctgtaaga
gtgtgcgagccatgtttttcagtcggagctttaaagaccactagcacttcaactaccact
accaccatcacatgtaagcaagctgttgcagatgatcaaaaaaatgtaaacattacttta
caaccagctccgtcaaattaa

DBGET integrated database retrieval system