KEGG   Aphis gossypii (cotton aphid): 114124882Help
Entry
114124882         CDS       T05869                                 

Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
ags  Aphis gossypii (cotton aphid)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ags03016]
    114124882
Enzymes [BR:ags01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     114124882
Transfer RNA biogenesis [BR:ags03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    114124882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ Tox-ART-HYD1
Motif
Other DBs
NCBI-GeneID: 114124882
NCBI-ProteinID: XP_027844128
Position
Unknown
AA seq 687 aa AA seqDB search
MGNRRNNGSNASFAKRRRKMKEGLDNKNPNEDTRSPYVTTIRENEKFVQYYKMQNICPED
EWNTFLETLKTDLPTSFRITASCDIEAKLLLKLVEGVFFTDLLKGEQSDEQKHSEPFCLP
WYPQRLGWQLKITRKDIRGSVAYYRLHNFLISETGNGNISRQETVSMIPPLLLDIKPSDK
VLDMCAAPGSKTAQLIEALYSGSNSSVPGGLVMANDVHNSRCYMLVHQAKRLNSANVLIT
NYDATVLPVMNLDENGHSMLKFDKILCDAPCSGDGTLRKNADIWTKWSPGNANNLHGIQF
RILKRGLELLNVGGRLVYSTCSFNPVENEAVVQRMMTEAQGSVVIINANDKLPGLKTVSG
LSQWIVVSKDLDVYKTFEEVPEKWNTQIRPQMFPPKEDLYNLDRCIRILPHHQDTGGFFV
AVMEKIKPLPWEASVTPSDELVDETKVNNYKRKPKKRKYQGYREDPFIFLTVDDPVWPEI
RDFYELKDFPIQCLLTRCSVGKKKNIYFTSPSVKDIVKNNQDRVKIINTGVKTFVRCDNK
SMECNFRLAQEGLAGISSYIGQKRRLQLTRNDLITVLINPTVQVTSLNEATKDILENFGV
GSCVLNMVDKDFPVELVGWKGFSTLKAYINGECRLHYLRLLGVDVSEFDVNKFKKENNDD
GTEDKNEIDEAPEVQVKEELTPSEKLE
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgggtaataggagaaataatggttcaaatgcgagttttgcgaaaaggagaagaaaaatg
aaagaaggattagataataaaaatcctaatgaagatactcgtagtccgtatgtaacaaca
atacgagaaaatgaaaaatttgtacagtattataagatgcaaaatatttgtccagaagat
gaatggaacacttttttagaaacattaaaaactgacttacctacttcatttcgcattact
gctagttgtgacatagaagcaaaattactattaaaattggtcgaaggggttttttttaca
gatttgcttaaaggagagcaaagtgatgaacaaaaacacagtgaacctttttgtttacca
tggtacccgcaacgattaggatggcaattgaaaattactcgtaaagatattcgtggttca
gttgcctactatcgtttacataattttctaatttctgaaactggaaatggcaatatttct
agacaagagacagtcagcatgattccacctttattattggatataaaaccaagtgataag
gtattagatatgtgtgcagctcctggttctaaaactgcacaacttattgaagctctgtat
tcaggttctaattcttcagttccaggtggtttagttatggccaatgatgttcacaactca
agatgttatatgttagttcatcaagctaaaagattaaatagtgcaaatgttcttattaca
aattacgatgctactgttttacctgtcatgaacttggatgaaaatggacattctatgtta
aaatttgataaaatattatgtgatgcaccatgttctggtgatggtacattaaggaagaat
gcagatatttggactaagtggagtcctgggaatgcaaataacttgcatggaatacagttt
cgtatactaaagcgtggattagaattgttaaatgttggaggacgtttagtttattcaact
tgctcgtttaatccagttgaaaatgaagcagtagttcaacgtatgatgacagaagctcaa
ggtagcgttgttataataaacgcaaatgataaactccctggattaaaaacagttagtggt
ctttctcagtggatagtggtatcaaaagatttggatgtatataaaacttttgaagaagtt
ccagaaaaatggaatactcaaattaggccacaaatgtttccccctaaggaagatttatac
aatttggatagatgcattcgtatattacctcatcatcaagatactggagggttttttgta
gctgttatggaaaaaattaagccattgccatgggaagcaagtgtaactccaagcgatgaa
cttgtggatgaaacaaaagtcaataattataaaagaaaaccaaagaaaaggaaataccag
ggttatagagaagatccatttatatttttaactgttgatgatccggtttggccagaaatt
agagatttttacgaacttaaggattttcccattcaatgtttacttacaagatgttctgtg
ggtaaaaaaaaaaatatttattttacgtcaccttctgtaaaagatatagtaaagaataat
caagatcgtgtaaagattatcaatactggtgtaaaaacatttgtccgctgtgataataaa
tcaatggaatgtaactttagacttgctcaagagggtttggctggaatatcttcttatata
ggacaaaaaaggcgattacaattaacacgtaatgatttgataactgtattgataaatcca
acagttcaagttacatctttaaacgaggccacaaaagacatactagaaaattttggtgtt
ggtagttgtgttttgaacatggtagacaaagattttccagttgagctggttggttggaaa
gggttttcaactctcaaagcttatataaatggtgaatgtagattacattatttgagattg
cttggagttgatgtctcagaatttgatgtgaataaatttaagaaagaaaataatgatgat
ggaacagaagacaaaaatgaaattgatgaagctccagaagttcaagttaaagaagaatta
acaccaagtgaaaaattagaataa

DBGET integrated database retrieval system