KEGG   Aphis gossypii (cotton aphid): 114125361Help
Entry
114125361         CDS       T05869                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00450  Selenocompound metabolism
ags00970  Aminoacyl-tRNA biosynthesis
ags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    114125361
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    114125361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ags01007]
    114125361
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ags03016]
    114125361
Enzymes [BR:ags01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     114125361
Amino acid related enzymes [BR:ags01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   114125361
Transfer RNA biogenesis [BR:ags03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    114125361
 Prokaryotic type
   Other AARSs
    114125361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 114125361
NCBI-ProteinID: XP_027844777
Position
Unknown
AA seq 508 aa AA seqDB search
MFFKCTFFLDPHIGHLYSALIADASARFQKLLNPSLNIIFSTGTDEHGLKVQKAAENCKL
SVENYCTKISNSYETTFNKFDISHTSFIRTTAENHKKCVHHFWSKLEPNIIKGKYSGWYC
TADETFLSQDQIELVNNERVSKESGRPVEWAEEDNYKFDLRPFKHDLQCWLNKPNRIKPK
VFHEILIKEANDLYDISLSRPQSRVSWGIPVPRDNTQTVYVWLDALVNYLTVSGYPDSKI
WPPNVQVCGKDILKFHGILWPIFLLAAGLKLPEQIFVHSHWKVNDEKMSKTKGNVVDPIN
AGCQYTESGLRYFLLREGTAHSDGNYSDLKIRRILNAELADTLGNLLNRCCGKAINPNLS
YPELDLIQFERLFADSYFIELNNKLEGLEDIVGSHYEELNFYKGIDEIIATLQCCNRFFE
YNKPWELAKKDVEKLECILLVTMETLRISGLALQPIVPVLADQLLNKLNINNRNWNQITP
KWKNKNRIVNPSNLKKDNIVLFKKLLIN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaatgtactttttttttagatccacacattggtcatctttacagcgcttta
atagctgatgcctctgcaagatttcaaaaattacttaatccaagtttaaatattattttt
agtactggtacggacgaacatggattgaaggttcaaaaagctgctgagaattgtaaatta
tccgtggaaaactattgtacaaaaatttcaaatagttatgaaactacatttaataaattt
gatattagtcacacatctttcatacgaacaacagcagaaaatcataaaaaatgtgttcat
catttttggagtaaattagaaccaaacattattaaaggaaaatattctggttggtattgt
acagctgatgaaacttttttgtcacaagatcaaatagaattagttaacaatgaacgtgtt
agtaaagaatcgggacgaccagttgaatgggctgaagaagacaattataaatttgatcta
cgtccttttaaacatgatcttcaatgttggttaaataaaccaaatagaattaaaccaaag
gtattccatgaaatactgattaaagaagcaaatgatttatatgatatatcgttgtcaagg
ccacaaagtcgagtcagttggggtattccagtcccaagagataatacacagactgtatat
gtatggctagatgctttggttaactatttaactgtttcgggttatccagacagcaaaatt
tggcccccaaatgtccaagtatgtggtaaagatattttgaaattccatggaatattgtgg
cctatattcttattagctgcagggttaaaattaccagaacaaatttttgtacattctcat
tggaaagttaatgatgaaaaaatgtccaagaccaaaggaaatgtagtagatccaataaat
gctggatgccagtatactgaatctggtttaagatattttttgctcagagaaggtacagct
cacagtgatggtaactacagtgatctgaaaattagaagaatattaaatgctgaattagca
gacacattgggtaacttattgaaccgttgctgtggaaaagctattaatccaaacctcagt
tacccagaattagatttaatacagtttgaaagactattcgctgattcatatttcattgaa
ttaaataacaaactagagggtcttgaagatattgttggaagtcattatgaagaattgaat
ttttacaaaggtatagatgaaataatagccacattacagtgttgcaatcgattttttgaa
tataataaaccatgggaattagctaaaaaagacgttgaaaaattggaatgtatactactt
gtaactatggagactttgagaatttctggattagctttacagcctattgtacctgtacta
gctgatcaattattaaataaattaaatattaataatagaaattggaatcaaattactcca
aaatggaaaaataaaaacagaattgttaatccttctaacttaaaaaaagataacattgta
ttgtttaaaaagttgttgataaactaa

DBGET integrated database retrieval system