KEGG   Aphis gossypii (cotton aphid): 114125494Help
Entry
114125494         CDS       T05869                                 

Definition
(RefSeq) glutathione hydrolase 1 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00430  Taurine and hypotaurine metabolism
ags00480  Glutathione metabolism
ags00590  Arachidonic acid metabolism
ags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    114125494
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    114125494
   00480 Glutathione metabolism
    114125494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ags01002]
    114125494
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ags04090]
    114125494
Enzymes [BR:ags01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     114125494
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     114125494
    3.4.19.14  leukotriene-C4 hydrolase
     114125494
Peptidases and inhibitors [BR:ags01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   114125494
CD molecules [BR:ags04090]
 Proteins
  114125494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept PepSY_like Colicin_D
Motif
Other DBs
NCBI-GeneID: 114125494
NCBI-ProteinID: XP_027844974
Position
Unknown
AA seq 587 aa AA seqDB search
MIIRLPSKRCSFFIGLAILITTAVLSLFVYFRFYVKNEIQDPEFPQPPSSLPMGVYSKVG
VVSNGGPCSQIGVDVMSKGGNAIDAAIATLLCDGAVCPQQMGIGGGFIMSIYNATTKKVM
SINARETAPAGANTYMFVKDPRKSMYGGLAVAIPGALKGYSTIYNLYGGGVQWETLFEPT
IKLCEEGITISDHLDFSLKFDEDLVKNDTMLRNIFFDENGEYMKTAGETYKLPKLASTLK
IIAKEGVKAIYNGSLTSKIIHDLKKVNGIITKKDLADYKVKIEESFSVNLTSGHTIHLGP
PPGSGIILAYILRVLDGILPAPDVGLDEHRLVEAFKFGYGERSHLGDHQFVNVSQIYNKV
NSDSYIESIRNKILDDFTSLDPRYYGGDFYTPEDHGTANIVVTDSTGNTVVCTSTVNTFF
GSGFMSPNTGIIFNNQMNDFSTPGVVNFYGIPSSPANYIKPGKRPMSSMCPTVFTDKNGD
FVLGAGAAGGSKITLTTAYIAAHKLWYNNTLKEVLDKPRIYHQLVPMEIRYEYRTTKDVV
QKLKDIGHPVTRMHYTRGSAASAISKSPTGMIEAMSDFRRPGNTSGY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcagattaccttcaaaacgatgcagcttttttattgggctagcgatattaatt
actaccgcagtgttgtctctattcgtatatttcagattctacgtcaaaaatgaaattcag
gatcctgaatttccccagccaccgtcaagtttgccaatgggagtatacagcaaggtcggc
gttgtgtctaacggtggaccatgttcacaaatcggagtggatgttatgtcaaaaggcgga
aatgcaatagatgcagctatagctactttgttatgcgacggggcagtttgtccacaacag
atgggcattggtggcgggttcataatgagcatttataacgcaacgactaaaaaagtaatg
tcaatcaacgcacgtgaaacagctccagcaggagcaaatacatacatgtttgtaaaagat
ccgagaaaatctatgtacggaggactggcggttgcaattccaggagcccttaaagggtac
tcaacaatatataacttatatggtgggggcgtgcaatgggaaacgttgttcgaaccaacc
ataaaactatgtgaagagggtataacgatcagtgaccatttagattttagcttaaaattt
gacgaagatttggtaaaaaacgatacaatgctcagaaacatttttttcgacgaaaacggt
gaatacatgaagacggcaggggaaacatataagttaccgaaattagcatcaactctaaaa
atcatagcaaaagaaggtgtaaaagccatatataacggatcgttaacatccaaaataata
cacgatttaaaaaaagtcaatggtattattacgaaaaaagacttggcagattataaggtt
aaaattgaagaatctttttcagtgaacttaacaagtggacatacaatacatttaggacca
ccacctggttctggtataatattagcttatattctccgtgtactagacggcattttaccg
gcgcctgatgtaggcttagacgaacatcggttggtagaagcttttaaatttggttacggc
gaacgatcacatttaggagaccatcaattcgtcaatgtatctcaaatttacaataaagta
aactcggatagttacattgagagtataagaaataaaattcttgatgattttacttccttg
gatccgagatactatggtggtgatttttatactccagaagaccatggaacggctaatata
gttgtcaccgattcgacgggaaacactgtcgtgtgtaccagtacagtaaatacatttttt
ggaagtggtttcatgtcaccaaacactggcatcattttcaacaatcaaatgaacgatttt
tctactcctggagtcgtaaatttctatggaattccatcttcaccagccaattatataaaa
ccaggaaaacggccaatgtcgtctatgtgtccgactgtatttaccgacaaaaatggtgac
tttgttctcggagcgggagcagctggaggatcaaaaattactcttactacagcatatatt
gctgctcataaattatggtataataatacgttgaaagaagtattagataaacctagaata
taccatcaacttgtacccatggagattcgatatgaatatcgaacaacaaaggatgttgta
caaaaacttaaagacattggtcatccagtaactaggatgcattatactcgagggtcagca
gcatcggctattagcaaatcccccacaggaatgatcgaagctatgtcagattttcgacga
ccaggaaatacatcaggatactaa

DBGET integrated database retrieval system