KEGG   Aphis gossypii (cotton aphid): 114126496Help
Entry
114126496         CDS       T05869                                 

Definition
(RefSeq) cholesterol 7-desaturase
  KO
K14938  cholesterol 7-desaturase [EC:1.14.19.21]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    114126496
Enzymes [BR:ags01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.21  cholesterol 7-desaturase
     114126496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-GeneID: 114126496
NCBI-ProteinID: XP_027846249
Position
Unknown
AA seq 439 aa AA seqDB search
MEKSIISILAVSLSVQLMREYCSGDCCKYVAVGVCASLGLWYGYRFLIRPLDIQRKLADV
GYKQHFTQNQWASKDKLHLIRSMMRLRKKGALPPVYPNGWFALLDSDQVNVNQVKYVTAL
GENFAVFRASNGDVNILNAYCPHLGANMAIGGIVKGNCLQCPFHGWAFDGTSGKCVRIPN
DCSSNGLLRKTASVKRWESCEANGFVFVWYHAENEAPSWRPAADVQLTGRGWTYRGRSEH
YVNAHIQDIPENGADVAHLPALHGHMALGGQYAAQADRSPWRWLGVHEWTAAWRADGTRG
SHVSALDLQHRLLMFGKFAVFNLNVEAQHIGPGLVILNFKTSFGPIKLIQVVTPVEPLIQ
KVVHRIYCPTYLSLYATIVLFMEAVMFERDVVIWNHKSYVEKPLASKQEATLLAHRKWYK
QFYSANSKQFSNRKETIDW
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcgataatttctattttggcagtcagtctatcggttcagttgatgcgtgaa
tactgtagtggcgactgctgcaagtacgtggctgtaggagtttgtgcatcattgggattg
tggtacggttaccgctttttgatcaggccattggacatacaaaggaaattggctgatgtg
ggttacaaacagcatttcacacaaaatcagtgggcgtcaaaagataagttacacttaata
cgatccatgatgaggctaaggaaaaaaggagcattaccaccagtttatccaaatggatgg
tttgcgctcctggactcagatcaagtcaacgtcaatcaagttaaatacgtgacggcttta
ggagaaaattttgcagtgtttcgtgcgtccaacggcgacgttaacatactaaacgcttac
tgtcctcatttgggtgctaatatggctattggaggaatagttaaaggaaactgtctccag
tgtccgtttcatggatgggcatttgacggtaccagtgggaagtgtgtccgaataccgaac
gattgcagttcgaatggactgttgcggaagacggcgtcggtgaagagatgggagagttgt
gaagccaacggattcgtgttcgtgtggtaccacgcggagaacgaggcgccgtcgtggcgt
ccggccgcagacgtccagctgaccggccggggatggacgtaccgcggccgcagcgagcac
tacgtgaacgcgcacatccaagacatcccggaaaacggggcggatgtggcccaccttccg
gcattgcacggccacatggcgctgggcggccagtacgccgcgcaggccgaccggtcgccg
tggaggtggctcggcgtccacgagtggacggccgcttggcgagcggacggcacgcgcggc
agtcacgtgtccgcgctcgacctgcagcataggctactgatgtttggaaagtttgcggtt
ttcaatctgaacgtggaagcgcaacatataggtcctggattagtgattttaaattttaaa
accagttttgggcccataaaattgatccaagttgtcacacctgttgagccattgattcaa
aaagttgttcatcgaatctactgtccaacgtatttatcactgtatgctacaatagtttta
tttatggaagctgtaatgtttgaaagagatgtagttatttggaatcacaagagttatgta
gaaaagcctttagcttcaaaacaagaagcaacattattggcacatagaaaatggtacaaa
caattttatagtgctaatagcaagcaatttagcaacagaaaagaaacaatagattggtga

DBGET integrated database retrieval system