KEGG   Aphis gossypii (cotton aphid): 114128085Help
Entry
114128085         CDS       T05869                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00010  Glycolysis / Gluconeogenesis
ags00562  Inositol phosphate metabolism
ags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114128085
   00562 Inositol phosphate metabolism
    114128085
Enzymes [BR:ags01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     114128085
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     114128085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 114128085
NCBI-ProteinID: XP_027848310
Position
Unknown
AA seq 497 aa AA seqDB search
MLVLIAILLSTSQVLAKFTSRFKDPSFPQYPNDMRGIPFRLGSMTPYHPPDKTCVAIRGH
CTVRHGAKFPKEDVQNGISGLNFIQDHLNTQYEDENKLNALPPENKEVVHKIMKWVNKTS
EKSSKEINEHGLLTMYKLGRRWNSRLLNIVTSIKSEKDIEFNSAKEHRCIESGQEFLKGF
LKIQKEKDSTVIKIPPAKIPEIGGADHRIKLDKGKPEVKGERKPKNPDEEEVEIKFFNKV
CPQNTCYLIDKIGKLLFPSDDEWKTWRDKITSAKIWAMYMACANSYVYEYSKEEEGQAWC
HVFDNDDIIMFENMNDYQYYVKNGYNDIKTKNYGHPMMRDILKFLNEKDTEKFKLFASHT
SNCLSLITGFRMLEDEVKLSLENMTEGDKMNNRKWKSSLIGNYACNIMVVVYECENAKYK
ISEEVSIFLNETPLEMVFENERTCTQCPIEDVKNLIEELLNDLPTAEELKEYENSQKGKI
VQEKIGETSISESSVKT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttagttcttattgctatattattatcgacgtcgcaagtgcttgcaaaatttacttca
cgattcaaagatccgagttttccacagtatccaaatgatatgagaggtataccatttagg
ttgggctcgatgacaccataccatccaccagataagacatgcgtagcaataagaggccat
tgtacggtgagacacggagcaaaatttccgaaagaagatgtacaaaatggcatttctgga
ttgaactttatacaagaccatcttaatacacaatatgaagatgaaaataaattaaatgcc
ttacccccagaaaataaagaagttgttcataaaataatgaaatgggtaaataaaacgtct
gaaaaatcatcaaaggaaataaacgaacatggtttactaactatgtacaagttagggcgt
aggtggaattctcgattgttaaatatagtaacaagtattaaaagtgaaaaagatatagag
tttaattcagcaaaagaacatagatgtattgaaagtggtcaagagtttttgaaagggttt
ctcaaaattcaaaaagaaaaagattcaactgtaataaaaatacctccggctaagatccca
gaaataggaggtgccgatcaccgaataaagttggataagggtaaaccagaggtaaaagga
gaacgtaaacctaaaaacccggatgaagaagaagtggaaattaagttttttaataaagtg
tgtccacaaaatacctgttatctaatagacaaaattggtaaactattatttccatctgat
gatgagtggaaaacatggcgtgataaaataacaagcgctaagatctgggcaatgtatatg
gcatgtgctaatagttatgtgtacgagtattcaaaagaagaagaaggacaagcatggtgt
catgtatttgataatgatgatataataatgtttgaaaacatgaatgattatcaatactac
gttaaaaatggatataatgatataaaaactaagaattatggtcacccaatgatgagagat
atactgaagtttttaaatgagaaagatactgaaaaattcaaattatttgcttcacatact
tcaaattgtctgagtttaatcaccggattccgtatgcttgaagacgaagtcaaattatca
ctagaaaatatgacagagggtgataaaatgaataatagaaaatggaaaagttctttaata
ggcaattacgcatgtaatataatggttgtagtttacgaatgcgaaaatgccaaatacaaa
atatcagaggaagtttcaatttttttaaatgaaacccctttagagatggttttcgaaaat
gaaagaacgtgtacccaatgtccaatagaagatgttaaaaacctaattgaagaattattg
aatgatttaccaacggccgaagaattgaaagaatacgaaaactcacaaaaaggaaaaata
gtacaagagaaaatcggcgaaacaagtatttctgaatcatcagttaaaacttaa

DBGET integrated database retrieval system