KEGG   Aphis gossypii (cotton aphid): 114128166Help
Entry
114128166         CDS       T05869                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
ags  Aphis gossypii (cotton aphid)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ags01001]
    114128166
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ags04131]
    114128166
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ags04812]
    114128166
   04147 Exosome [BR:ags04147]
    114128166
Enzymes [BR:ags01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114128166
Protein kinases [BR:ags01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   114128166
Membrane trafficking [BR:ags04131]
 Others
  Actin-binding proteins
   Others
    114128166
Cytoskeleton proteins [BR:ags04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     114128166
Exosome [BR:ags04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114128166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Titin_Ig-rpts V-set C1-set BiPBP_C Ig_6 Ig_4
Motif
Other DBs
NCBI-GeneID: 114128166
NCBI-ProteinID: XP_027848415
Position
Unknown
AA seq 4802 aa AA seqDB search
MNQQQQQKQITTTTTSSMSTGQRSVNRTEQQVTRQFTQTTQRQVHEGFIVQQSTPKFGND
AAPPVFEQIFKNARFAQGGNAVFEGKVTGIPKPFVSWTRKGAPLLESYKYKMTYDQQTGN
VVLTINQIGPGDEGEYTCSARNQYGEAICSVFIQPEGHTVQIPQGTYGSQRVQQTQNTLY
TNNYSNIDEDFKVDTFEYRLLREVSFRQSVTKRYLGEEDVKFTSSAHQGPVVAPQVLQKP
RNSKLVEGSNATFTVKVSTAKDTRLTWFKNGQRLVNGPKHQINFTNQIATLYIPQVSCED
SGHYTLLVENPQGCVVSSAYLAIEPMQIAYDRTEDKENVITKTHNKLESIEVVEGKMLAP
NFVRVCGDRDVTEGKLTRFDVRVTGKPYPEVSWYINGQQIKDDATHKILVNESGDHGLMI
TNVSQADAGQVVCVARSKSGETSFQCNLGVIEKELVVAPKFVQRFTPLNISEGETVTLSV
RAVGTPIPRITWQKDGVNISEQPGMVSVWTEGGGSVLEIARAAPTDAGWYQCTAQNTAGS
TATRARLNIIRKPRPEDFSEDRRLRLPKPTRVIEPEPEPEPEVVFLKHVERAKHHTPRSE
EDKIYPPPRFIVPLADITQQEDGRIHFEARIEPIGDPTMVAEWFVNGYPLQASSRAMTLL
NYGFIALDLLSIISEDAGEYTCRVTSSSGTAQSTAVLKVEGRDEIDKSSHYPDSLKYIEQ
LEDYSKYQRSDSYDEVQPLPPTLVKSLHDMGDLQEGRNAHFEAQLNPVSDPTMKVEWYKD
GKPITASSRITTIFNFGYVSLNIMHLRAEDSGEYTLRAINRWGEIISTSTLNVIAHSSIK
GDLGYPEQQRYIDQTEALEQSYLQQKNQEYKISAPESVAPPQFKTPIKDQQNIKEGGFAH
FEARLEPLGDSTLQVVWLKDGKPVEASSRMTVFFNFGYVALTIKYVTAFDIGTYTCRAFN
NLGDASTSATLTVLTKKDVVQDSQHPGGLERFQYLEDSRKNKRKAEEETVVTQKPRFLGP
LKGTNKIAEGQRAHFEVRVEPQNDVTMKIEWYFNGRVIMSANRIQTYHDFGYVALDILGV
RAEDSGTYVVVARNALGEAQLSATMQVEVRSNIDTSTMHRGVVEKAPYLESKKFTEPQYD
IEEISKSKPIFIQPLSDPAPLNEGKNVHLECRLEPMGDPTMRVEWFQNGKPVTVGSRFRT
YYDFGYVALDIIHVTSIDSGEYTVRATNHLGSAHTSACVNVLCRSDILTESQNEYALEQI
QMLEDASRYQKMTIEEESIMQGPQFTKPLHNIQTSEGTNVHLECRLKPVGDPTMKIDWLV
NGRPVKTGHRFRPAYDFDYVALDLLSVYPEDSGVYTCQARNEMGEAVTSSSVKVIAKQNL
ILDSQHPHGLEKIQYLEDSARYKKAEMIEESVKIKPRFLTKPKNVENLKEGQHAHFECKL
EPVTDSNLEVQWFKNGKPIIIGHRFRPIHDFGYVALDIIDVIEEDSGIYTCRAVNLLGVD
ETNAHLTCRSSSSIVTDTQNEMGLEQIQYLEEKSRYHRREDIEETTTQAPIFTTSLKHCD
IKEGQRAHFECRLIPVSDNTMKVEWFHNNVPIKFGSRFTETNNFGFVALDILQCLPEDSG
TYTCRATNWLGQSITSGNLNVQSRKSIYLESQHEDALGRLAQLENSNRYQRQSIIEDVVT
QAPVFTQPMRDITMIESQPAHFEARLIPVGDDKLKVEWLRNGIPIQASNRVSTMHDFGYV
ALNLKYVYPEDSGTYTCRAINDLGQAVTSATLNVHSKASLQLESQHEAALDKLRQLEDSI
KYKRVEQKEVEVTEAPKFIVPLNGTESLIEGQSAHYECRIEPYPDHTLQLEWLHNGKPLQ
TGHRFRTTYDFGFASLDVLSALPEDSGEYTCRAINKFGRAESSVKLSVQSRASIISDTQH
QGALNKIQYLEDDSRFKRAAAEDVLMTEKPQFGRPLKNIEHLPEGQSVHLEATLIPVNDP
TMKVEWFRNGIPIPQGHRFKTVYDFGFVALDVLYAYPEDSGTYMCKAKNAAGEAVTTCIV
TVDSKSGLQLDTLDEDRLKKIKQLEAYERPTAQEAVFELQKPVFLTPLNSLELLKEGEHA
HLETRIEPINDADLKIEWFVNGVAIKTGHRFKTTHDFGYVALDILYAYAEDSGTYMCKAT
NKKGEAVNTCQINVASRRSIYLETQHPDGLEKIRELEAQGHPAKLEIDEPPPTAPSLTSL
WGTTEVAEGKTAHFECQVKPVHDSKLKVEFFHNDKPLGSASRFHTTYDFGYISLDIGHVV
PEDAGKYTVKATNELGQATSSINLLVQGGGSIILDSQRPEGLEKIKELEMAVPFKRADYS
EPISKQRPMFTQPLQNIDSINEGQTAHFECRLIPIGDASMTVEWFRNEKPLETSSRITKT
YDFGYISLDISHVRDEDNGVYSCKATNALGEAVSTASMRVRTKSDIQLESQHPEGLRKIV
ELERGQEPLKREEAERSFEKPIFTQLLTGPSELIEGQHAHFECRVVPVGDPTLRFEWYVN
GVELKMGSRFHVTNDFGFVTLDISSTVAEDSGVYTCKAINRAGEAVSSTSMKIKHRSSIV
HEPLQPDAWEKIQLKEAEMNKVPEMFIDTRPQQAPVFTSHLQNQDRLAEGQHVHLEAQVE
PRADPNLRIEWFKNGVALTTGSRIRSTFDFGLVTLAINSLRPDDSAIYTCKASNMLGEAV
STCTLKISDSHWLISNTLHPESLSKIEDLEKPHAGRVEGPEPVFESPVFISHLNNWECKE
GSDVHFECQVEPSKDPTLKIDWFVNGKPLQSASRFKSAYDFGFVTLDIHHAYSEDSGIYT
CRASNSKGQAVTTGTLKCTGLQGIHLDTQHPQGKTGLEKVQKVEDNLASKYQRQASLPDA
TFPKPIFVVPLEAEFILAESKPLHLEAQVEPKNDPNLKIEWYFNGKVLDLGSRFKTNNDF
GFISLDLTDVYERDQGVYTCKAYNHSGETYTSTTVYCSSNKGLIEHTQHPKGEEGLEKIQ
SLEESLQRQKQGITDRETGHAPVFTSQFKDLGFLSEGEIAHYEASLTPVGDQKMVVEWFY
NGNAIEASHRIRTIYAFGMVVLEILGTKIADTGTYTCKATNDYGSAEMSVTLECVERITG
QKPKFTSQIQTLVGLKDGDSAHFECTLIPVNDPDLKVEWFHNGKPLLHKNRVKMISDFGF
VVMDIAYIQNHDSGEYVCKASNKYGEDITKASIQYSGKGGVYLDSLQPSSLARIHELENA
TGQPVGFASSPVSEAPKFTTQLVDITNLKEGQSAHFEARVTPVNDPNLVVEWYFNGEKLQ
HGHRFRTFHDFGIVILDILYCYEENSGVYECRASNKAGNDTTKANLRCSSKTNLILDSQL
PRGMEGGLEKIQTLEDLTLRVKDEKVSVENRQAPMFTEPLSNIDSLREGESAHFEGRLTP
VDDPNLKVEWFWNGKPLKAGSRFRTFCEFGFVILEISPVYPEDSGEYSCRASNHYGEAVT
TASMKVQGKRSIIVESQLPKGMDTTIDRIAELEGLGKSRAPIETEDDLGRAPEFITTPAD
LSLSENSLAHFECRLVPSNDASMTVTWFHNGKVLSAGSRIKTINDFGFVILEVAGVYIRD
SGLYTCKATNKHGEATVTCKLQVKGRQGIVLEPQLPNTFRSGTKSIQKLEENMYKKEEIL
AEDEKPNPPRFTVELKDALDVQEAKSVHFECRVEPVNDSTLRIDWFFNGKPFATGSRVHV
INDFGFISLDMDYVYSRDSGEYICRATNKWGTAFTKAKLTCIAKQNVILESQLPEGMSGE
KLKALEQGPVQEKKIHDEIEAMPPKFLSQIESTTVEEASSVHFETRVEPKNDPKLRVEWY
RNGKPLPSGHRYKSIFDLGFVSLDILSMYSEDSGEYICRAVNDHGEAITKAMVTCKQLPT
ILLQNQVPKGMKKSEALTQMEAAIKKYTSEIHLTIDDLYEVEKKQPPRFVTQIKDQLSLV
EMESTKFECQLAPVGDPNMKVEWFLNGKPLRHKNRFNPIYDFGYVAMNFGWIYPEDSGEY
VCRATNLYGQDETRATIKTSGKPGIIYDSQLPKGMKSIEKIREMEASWQVTPEMKEEEEK
RREPPQFVSKPEPVTICEGDWARFCCRVTGFPRPRVMWLVNGNTVVNGMRYKLNYDGMWH
LDIPKTRQYDHGKVEVIARNACGETRVETMLTVNSRHDDYRGVLKNSPRPWYDSDLVQYQ
RDLKENELEKVFTDRASNVQNVDYSNMIISTVGDQMKQKQLGEPKPEWTETVKQKKNEDY
YNKLSKLEGDQVVKEARIREANHQISIAGEKLKTTSKNMSKNYEESLVKDKKEELMPWQT
TKLLKARGDQSPQIIPDPSESAVHGKEIHVAKQQQTQKEIQGDKEIRRKITATETTEVEH
TRKNQERVVQGKVEPSKPPIFTTKIQPCRAFEQDQARFEVEFDGEPLPTIKWYREDFLIQ
NSPDFQIHTFSTKSILVIRQVFMEDSGVFAVIAENRGGKAKCSANLLVEERKQVGRKGPG
PPSFLSTMQGSVVKAGQLVRFDVKISANKPLDVYWLKNGKKITQDIRYKTVDEDNQYTLL
IIESVTEDSGTYECVAINNSGEARCEAQLVVQPLEQKDKPKSKPSGKEQAPTITQPLSGQ
VIHEGQPVTFSCKISGQPPITVKWQKGDKVIKPSKYFRMTQDGETVSLHISEVFPEDEGT
YKCLVSNAGGQAVLSANLKVIVPENQDIAPTLSPMRDVIVPEGNAAQFRTQVSGQPSPSV
QWFREGILIPETPDFKMMYEGNMAVLLITSTYEEDSGVFTCRATNSAGQVETSARLTVKS
KK
NT seq 14409 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaacaacagcaaaaacagattaccaccaccaccacctcctcgatgtccacg
ggacagaggagcgtgaaccgtaccgaacaacaggtcacgagacaattcacgcagaccaca
cagagacaagttcacgaagggtttattgtacagcagtctactccaaaatttggaaatgac
gctgctccgccagtgtttgaacagatattcaaaaacgccagattcgcccaaggcggaaat
gccgtttttgaaggaaaggttaccggtattccaaaaccttttgtctcatggaccaggaaa
ggcgctccactattggagtcatacaaatacaagatgacgtatgatcaacaaacagggaat
gttgttcttacgatcaatcagatcggtccaggagatgaaggtgaatacacgtgttcggcg
cgcaatcaatacggcgaagctatttgttctgtttttattcaaccagaaggtcataccgtt
caaatacctcaaggcacgtatggttcacaacgagtacaacagacacagaatacgctgtat
acaaataattattcgaacatcgatgaagatttcaaagtcgatactttcgaatatcgctta
ctccgtgaagtgtccttcagacaatctgtcaccaaaaggtacctgggtgaagaggatgtc
aagtttacaagcagcgcacaccaaggcccggtcgtagcaccccaagtgcttcagaaaccg
cggaactcaaaattagtagaaggttcaaacgctacatttactgtaaaagtgtcaacagct
aaggatacaaggttgacttggttcaagaatggccagagactcgtaaatggaccaaaacac
caaattaattttactaaccaaatcgctacactttatataccacaagttagttgtgaggat
tctggacattacactctgcttgtagaaaacccacaaggctgtgtagtttcttctgcgtat
cttgccatagaaccaatgcagatagcatatgatagaacagaagacaaggagaatgtaata
actaaaactcataacaaactggagtcgatagaagtggttgagggcaagatgttagcacca
aactttgtgcgtgtttgtggtgaccgtgacgtgaccgaaggaaaattgacacgtttcgat
gtccgtgttacgggtaaaccgtatcccgaagtctcgtggtacataaatggtcagcaaatt
aaggacgacgcaacgcacaagatattggtcaacgaatctggtgatcacggtttgatgata
actaatgtttcccaggcagatgcaggtcaggtggtttgtgtcgcaagaagtaaatctgga
gaaacttctttccaatgtaatctgggagtcattgaaaaagaacttgtagttgctccaaag
tttgtacagcgttttacacctttaaatataagtgaaggagaaacagttacattgagtgtc
agagctgttggaactccaataccaagaataacatggcaaaaagatggtgtcaacatcagc
gaacaaccaggaatggtatctgtatggaccgaagggggcggttcagtattagaaatagca
agagctgctccaacggacgcaggttggtatcaatgcacagctcaaaacacagctggatcg
acagcaacacgagctcgccttaacatcataaggaaacctcgccccgaagacttctctgaa
gacagacgtcttaggctaccaaaaccaacacgagtaattgaacctgagcctgagccagaa
ccagaagttgttttcctaaaacatgttgagagagcaaaacaccatacacctcgatcagaa
gaagacaaaatttatccaccaccacggttcattgttccgctagcagatataactcaacaa
gaagatggtcgaattcattttgaagctagaattgaacctatcggtgatccaacaatggtg
gctgagtggtttgtaaatggttacccattacaagcaagttcgagagctatgactttatta
aattacggtttcatagctttggatttattgagcattatatccgaagatgcgggagaatat
acatgtagagtgacaagtagttctggaacagctcaatctactgctgttcttaaagttgaa
gggagagatgaaatcgataaatccagtcattatccagatagtttaaaatatattgaacaa
ttggaagattattccaaatatcaaagaagtgatagctatgatgaagttcagccattacca
cccactttagttaaatcattacatgatatgggtgatttacaagaaggtagaaatgcacat
ttcgaagctcagctcaacccagtcagtgatccaacaatgaaagtagagtggtataaagat
ggaaaacctataacagcaagttcaagaataacaacaatatttaattttggttacgtttca
ttaaatattatgcatcttcgtgcagaagatagtggagaatatactttaagagctataaac
cgatggggagaaattattagtacatcaacattaaatgtgatagctcatagcagtattaaa
ggcgatttaggctacccagaacagcaaaggtatattgatcaaactgaagctttagaacaa
tcctacttacaacaaaaaaatcaagaatataaaataagtgcacctgaaagtgtagcacca
ccacaatttaaaacgccaattaaagatcagcaaaacattaaagaaggcggttttgctcat
tttgaagcaagattagaaccattaggagattcaacgcttcaagtagtatggttaaaggat
ggtaaaccagttgaagctagttcaagaatgactgtatttttcaactttggatatgttgca
ttaacaataaaatatgtaactgcttttgatatcggaacatatacttgcagagcttttaat
aatttaggagatgcttcaacatctgctacattaactgttcttactaaaaaagatgtagta
caagatagccaacatcctggaggtcttgaacgattccaatatttggaagattcaaggaag
aataaacgaaaggcagaagaagaaaccgttgttacacaaaaacctagatttcttggacca
ttaaaaggaacaaataaaattgctgaagggcaaagagctcattttgaagttcgagttgaa
cctcaaaatgatgtgactatgaaaattgaatggtattttaatggaagagttataatgagc
gctaatagaattcaaacatatcatgattttggttatgtggctttggatattcttggtgta
agagctgaagatagcggtacatatgtggttgtcgcaagaaatgccttgggagaggctcag
ctgtcagctacaatgcaagttgaagttcgttcaaatattgatacatctactatgcatcgt
ggagtagttgaaaaagctccttatcttgagtctaaaaaattcactgaacctcaatatgat
attgaggaaatttcaaagtcaaaacctatattcatacaaccattaagtgaccctgcacca
ttgaatgagggtaaaaatgttcatttggaatgtcgccttgagcctatgggtgatcctaca
atgagagttgaatggttccaaaatggtaaacctgtaacagtcggttcaagattccgtaca
tactatgattttggatatgttgctttggatatcatacatgtcacatcaattgactctggt
gaatacactgttagagctacaaaccatttaggatcagctcatacatctgcatgtgttaat
gtattatgccgatcagacattttaactgaaagtcaaaatgagtatgcattagaacagata
caaatgttagaagatgcatcaagatatcaaaaaatgacaattgaagaagaaagcattatg
caaggtccacagttcaccaaaccgttacataatatacagacatctgaaggtacaaacgta
catttggaatgtagattaaaaccggttggagatccgactatgaaaatagattggttggtc
aacggacgtccagtgaaaacaggacatagattccgccctgcctatgattttgattatgta
gcattggatttgttaagtgtgtatcctgaagattctggtgtatatacttgccaagctaga
aacgaaatgggcgaagctgttacttctagctcagtgaaagtaattgctaaacagaattta
atattagattcacaacatccacatggtctagaaaaaatacaatatctagaagattcagcg
agatacaaaaaagctgaaatgattgaagaatctgttaaaataaaacctcgttttttgacc
aaaccaaagaatgtggaaaatttaaaagaagggcagcatgctcattttgaatgtaaatta
gagccagtcactgattctaatctagaagttcagtggtttaaaaatggaaaaccaatcatt
attggtcatcgcttcagacctatccacgatttcggatatgtagccttagatatcatagat
gtcattgaagaagattctggaatttatacatgtcgtgctgttaatttacttggtgttgat
gaaacaaatgctcatttaacatgcagaagttcatccagtattgtaacagatactcaaaat
gaaatgggtctggaacaaattcagtatcttgaagaaaaatctagatatcacagaagagaa
gacattgaagaaacaaccactcaggctccaattttcactacttcattgaagcattgtgat
attaaagaaggccaacgagctcattttgaatgcagattaatcccggtatctgataacacc
atgaaagttgaatggttccataataatgttccaattaaatttggatctcgatttaccgaa
actaataactttggatttgttgcattggatattcttcaatgtttacctgaagattctggc
acatatacatgtcgtgcaactaattggttaggacaatctattacatcaggaaatctcaat
gttcaatcgagaaagtcaatctatttggaatctcaacacgaggatgcattaggtcgttta
gctcagcttgaaaactcaaatcgttatcaacgtcaatcaattatagaagatgtagtaaca
caagctccagtatttactcaacctatgagagatattacaatgattgaaagtcagcctgct
cattttgaggcaagattaataccagtgggtgatgataaattaaaagtagaatggttaaga
aatggaattcctattcaagcatctaatcgtgtatcaacaatgcatgattttggttatgtt
gctcttaatcttaaatatgtttatcccgaggattctggtacttacacatgcagagctata
aatgatttaggacaagcagtcacttcagccactctgaatgtgcattctaaagcttctctt
caattggaaagtcaacatgaagcagcattagataaattaagacagctcgaagattctatc
aagtacaagcgagtagaacaaaaagaagtggaagttactgaagcgcctaagtttattgtg
ccattaaatggaactgaaagtttaattgaaggtcaaagtgcccattatgaatgtcgtata
gaaccttatcctgatcatacactacaattagaatggttacacaatggaaaaccattacaa
acaggacatagatttagaacaacttatgattttggttttgcatcattggatgttttatcg
gctttaccagaagattctggagaatatacttgtagagctattaataaatttggtagggct
gagtcatcagttaagctaagtgttcaatctcgagcatctattattagtgatactcaacat
caaggagctttgaataaaatacagtatttagaagatgactctagatttaaaagagcagct
gctgaagatgttttaatgacagagaaaccacaatttggacgacctcttaagaatatagaa
catcttccagaggggcaaagtgtacatcttgaagctacattaattccagttaatgaccca
actatgaaggttgagtggtttagaaacggaataccaattcctcaaggccatagatttaag
acagtttatgattttggatttgttgctttggatgtactttatgcttatcctgaagactcg
ggtacatatatgtgcaaagctaaaaatgctgctggagaagcagttactacttgcattgta
acagtggattctaaatctggtcttcagttggatacattggatgaagatagattaaaaaaa
attaaacaacttgaagcttatgaaagacctacagctcaagaagctgtatttgaacttcaa
aaaccagtattcctcacacctcttaatagccttgaattattgaaagaaggcgaacacgct
catttagaaactcgaattgaaccaattaatgatgctgatttgaaaatagaatggttcgtt
aatggagtagcaattaaaacaggtcatcgttttaagactacacatgattttggatatgtt
gcattggatattttgtatgcatatgctgaagattctggtacttatatgtgtaaagccact
aataaaaaaggggaagcagtaaatacttgtcaaattaatgttgcctctcgtagaagtatc
tacttagaaacgcagcatcctgatggattagaaaagattcgtgaacttgaagctcaagga
cacccagcaaaacttgaaatcgatgagcctccaccaacagctccttcattaaccagtcta
tggggcactactgaggtagctgaaggaaaaacagcccactttgagtgtcaagtaaaacct
gtacacgattctaaattgaaagttgagttcttccataatgacaaaccacttggatctgct
tctcgtttccatactacatatgattttggttacatatctttggatattggccatgttgtt
ccggaagatgctggaaaatatactgttaaagctaccaatgaattgggtcaagctacttct
agtatcaatttattagttcaaggaggtggaagtataattttggattctcaaaggcctgaa
ggattagaaaaaataaaagagttagaaatggctgtacctttcaaacgtgctgattattca
gaacctatatcaaaacaaagaccaatgttcacacaacctctacaaaacattgacagcata
aatgaaggacaaacagctcactttgaatgtcgtctcatccctattggcgatgcgtcgatg
actgttgaatggtttagaaatgaaaaaccattagaaacaagttcaaggattacaaaaaca
tatgactttggttatatatctctagatatttctcatgtaagagatgaagataatggggta
tatagctgtaaagctacaaatgctcttggagaggcggtttcaacagcctctatgagagtt
agaacaaaatctgatattcagttagaaagtcaacatccagaaggtcttagaaaaattgtt
gaattagaacgtggtcaagaaccattgaaaagagaagaggcagagagatcatttgagaaa
ccaattttcacacaacttcttacaggcccttcagaacttattgaaggtcaacatgctcat
tttgagtgtagagttgtaccagtaggtgatccaacattacgttttgagtggtatgttaat
ggagttgaactaaaaatgggttcaagattccatgtaacaaatgattttggctttgtgaca
ttagacatcagttcaactgtcgcagaagattctggagtttatacatgtaaagcaattaac
agagctggagaagctgtttcttccacttccatgaaaataaaacatcgctcttcgattgtt
catgaaccattacaacctgatgcatgggaaaaaattcagcttaaagaagcagaaatgaat
aaagttcctgaaatgttcattgatacaagaccacaacaagcacctgttttcacttcacat
ttgcaaaatcaagaccgtttagctgaaggtcagcatgttcatttagaagctcaagtagaa
cctagagcagaccctaatcttcgaattgaatggttcaaaaatggagtggcattgacaact
ggttcaagaatacgcagtacttttgattttggtttggttacattagcaataaatagttta
agaccagatgattcagccatctatacatgcaaagcatctaacatgttgggcgaagctgtt
tcaacttgtacattaaaaatatcagatagccattggttaataagtaacactttacaccct
gaatcactttcaaaaattgaagatttggaaaaaccacatgctggacgtgttgaaggacca
gaaccagtttttgaaagtcctgtattcatttctcatcttaataactgggaatgtaaagaa
ggaagtgatgttcattttgaatgtcaagtagaaccttccaaagatccaactttgaaaatt
gattggtttgtaaatggaaaaccacttcaaagtgcatcaagattcaagtcagcctatgat
tttggttttgtcacattagatatacaccatgcatattcagaagattctggaatatacact
tgtagagctagtaatagcaaaggccaggctgtaactaccgggacattaaaatgtacaggt
ctccaaggcattcatttagacacacaacatccacaaggaaaaactggattagaaaaggta
caaaaagtggaagataatcttgcttctaaatatcaacgtcaagcatctttgcctgatgca
actttcccaaaaccaatatttgttgtacctcttgaagctgaattcatattagctgaaagt
aagccactgcatttggaggcacaagttgaacctaagaatgaccccaatctcaaaattgaa
tggtactttaatggaaaagtacttgatttaggatcacgttttaagacaaacaatgatttt
ggttttataagtttggatttaactgatgtatatgaacgagatcaaggagtgtatacttgc
aaagcatataaccattctggagaaacatatacttcaacaactgtttattgcagtagcaac
aaaggattaattgagcatactcaacatccaaaaggagaagaaggtttggaaaaaattcaa
agtttagaagaatctctacaaaggcaaaaacaaggaattacagatagagaaactggacac
gcacctgttttcacttcacaattcaaagatcttggattcttaagtgaaggtgaaattgct
cattatgaagcttcattaacacctgttggtgatcagaaaatggttgttgaatggttctac
aatggaaatgccatcgaagctagtcatcgtattcgtacaatctatgcatttggaatggtt
gttcttgaaattcttggtactaaaatagctgatacaggtacttacacttgtaaagcaaca
aatgactatggatctgcagagatgagtgttacactagaatgtgtagaaagaataactggt
caaaaaccaaaattcacatctcaaattcagactctggttggcttaaaggatggagattct
gcacattttgaatgcacattaataccagtcaatgacccagatttaaaagtagaatggttc
cacaacggtaaaccattattacacaaaaatcgtgtaaaaatgatttccgattttggattt
gtcgtcatggatatagcatatatacaaaaccacgattctggagaatatgtgtgtaaagca
agcaataagtatggtgaagatataactaaagcctctattcaatactctggaaaaggtggt
gtgtatttagattcattgcaacctagttccttggctagaattcatgagttagaaaatgct
acaggacaaccagttggatttgcatcatctcctgtatcagaagctcctaaatttacaact
caattagttgatataacaaatttgaaagaagggcaaagtgctcactttgaagctcgtgtt
acaccagtgaatgatccaaatcttgttgttgaatggtatttcaatggtgaaaagctacaa
cacggtcatagatttagaacattccatgattttggtattgtaatattggatatactttat
tgttatgaagaaaactctggtgtatatgagtgtagagcatccaataaagcaggaaatgat
actactaaggcaaatttgcgttgttcctcaaaaacgaacttgatcttagattcccaactt
cctcgaggaatggaagggggattagaaaaaattcaaactcttgaagatttaacacttaga
gttaaagatgaaaaagtttctgtagaaaatcgtcaagctccaatgtttactgaaccatta
tccaatattgatagtttgcgagaaggtgagagtgcacattttgaaggtcgcctgacacct
gttgatgatcctaacttaaaggtggaatggttctggaatggaaaaccattaaaagcaggt
tctagatttagaacattctgtgaatttggttttgttatattggaaatatctccagtatat
cctgaagattctggagaatattcatgccgagcttccaatcattatggtgaagctgttact
acagccagcatgaaagttcaaggaaagagaagtatcattgtggaatctcagcttccaaaa
ggaatggacactactatcgatagaattgcagaacttgaaggtcttggaaaatcaagagct
cctattgaaactgaagacgatttgggaagggcaccagaattcattactacaccagctgat
cttagtttatcagaaaattcgctggctcattttgaatgcaggcttgtaccatctaatgat
gctagcatgacggttacttggttccataatggcaaagtgttatcggccggatcacgtatt
aaaacaattaatgattttggatttgttatccttgaagtagctggtgtttatattagagat
tctggtctatatacttgcaaggccactaataaacacggagaagcaacagtaacatgtaag
ttacaagttaaaggccggcaaggtatagttttagaacctcaattgcctaacacattcaga
tctggtacaaaaagtattcaaaagcttgaagagaatatgtataaaaaggaagaaatattg
gctgaagatgaaaaaccaaatcctcctaggtttactgtagaactgaaggatgcattggat
gtacaagaagccaaatccgttcattttgaatgtagagtggaacctgttaatgattctact
ttaaggattgattggtttttcaatggaaaaccttttgctactggttcacgtgtacatgtg
ataaatgattttggatttatatctttagacatggattatgtttactctcgagattctggc
gaatatatatgccgtgcaacaaataaatggggaactgcctttacaaaagcaaaattaacg
tgcattgccaaacaaaatgtcatattagagtcacaattacccgaaggaatgagtggagaa
aaattaaaagcattagagcaagggccagtacaagaaaagaaaatccatgatgaaatagaa
gcaatgccaccaaaattcttatctcagattgaatcaacaacagtcgaagaagcaagttct
gtacattttgaaactagagttgaacctaaaaatgatccaaagttaagagtagagtggtac
agaaatggtaaaccattaccttcaggccatagatataagtctatatttgatttgggtttt
gtatctttggatatactgtccatgtattctgaagattcaggagagtatatttgtagagct
gtaaatgaccatggtgaagcgattactaaagctatggtcacctgcaaacagctcccaaca
atattacttcaaaaccaagtaccaaaaggtatgaaaaagtctgaggctttgactcaaatg
gaagcagctattaaaaaatacacatctgagattcatttgaccatagatgatttgtatgaa
gttgaaaagaaacaaccaccaagatttgttacccaaattaaagatcagttgtcgttagtt
gaaatggaatcaaccaaatttgaatgtcaattagctccagttggtgatcctaatatgaag
gttgagtggtttttaaatggcaaaccattaagacataagaatagatttaatccaatttat
gactttggatatgttgcaatgaattttggttggatatatcctgaagacagcggcgaatat
gtttgtagagctactaatttatatggtcaagatgaaacaagagccactataaaaacatct
ggtaagccaggtatcatttatgattctcagcttcctaaaggaatgaagagtattgaaaaa
ataagagaaatggaagcatcgtggcaagtaacacctgaaatgaaagaagaagaagaaaaa
cgtagagaacctccacaatttgtaagcaaaccggaacctgtcactatatgtgaaggtgat
tgggctagattctgttgtagagttactggtttcccaagaccaagagttatgtggctagtc
aatggaaacacagttgtgaatggaatgagatacaaattaaattacgatggtatgtggcat
cttgacataccaaaaacaaggcaatatgaccatggtaaagttgaagttattgctagaaat
gcatgtggagagactcgtgtggaaacaatgctcacagtgaattcaagacatgacgattac
agaggagttttgaaaaattcaccaagaccatggtacgacagtgatttggtgcagtatcaa
agagatcttaaagagaatgaactagaaaaagtgtttactgatagagcatcaaatgttcaa
aatgttgattatagtaatatgattatatcaacggttggtgatcaaatgaaacaaaagcaa
ttaggtgagccaaaacctgaatggactgaaactgtaaaacaaaagaagaatgaggattat
tataataaattgagtaaattggaaggagatcaagtggtaaaagaagcaagaatcagagaa
gctaatcatcaaatatcaattgcaggcgagaagttgaaaactacatctaaaaatatgtct
aaaaattatgaagaatcattagttaaagataaaaaagaagaattaatgccttggcaaaca
acaaagttacttaaagcacggggtgatcaaagtccacaaataataccagatccgtctgaa
tcggcagtacacggaaaagagattcacgtggcaaagcagcaacaaactcaaaaagaaata
caaggtgataaagaaatacgtaggaaaattactgccactgagacaactgaagtagaacac
acacgtaaaaaccaagaaagggtagtccaaggaaaagttgagccgtccaaaccgccaata
ttcacaaccaaaattcagccttgccgtgcattcgaacaggaccaagcgcgttttgaggtt
gaatttgatggtgaaccattacccacgataaaatggtaccgagaagactttttaatccaa
aactcacctgacttccaaatacatacgtttagtacaaaatccatactagttattagacaa
gtttttatggaagactctggtgtctttgccgttattgcggagaacagaggtggcaaagca
aaatgcagtgccaatttacttgtcgaagaacgtaaacaagttggcaggaaaggacctggt
ccaccaagcttccttagcacaatgcaaggatcagtggtaaaagccggtcaactagtcaga
tttgacgttaaaatcagcgctaataaaccactggatgtatattggttaaagaacggaaag
aaaatcacccaggacattcgttacaaaacggtggacgaagacaatcaatacacgctttta
atcattgagtcggttactgaagacagcggaacctatgagtgtgtagctatcaacaattct
ggtgaagcaagatgtgaagctcagttggtagtccaaccattggaacagaaagataaaccc
aaatcaaaacctagtggtaaagaacaggcaccaacaattacccaaccgttatccggacaa
gtgattcatgagggacaacctgtaacgttcagctgtaaaatttctggacaacctccaata
accgtaaaatggcaaaaaggcgataaagttatcaaaccatcaaaatatttccgcatgacg
caagacggggaaacagtttcacttcatatatccgaagtgttcccagaagacgaaggcacg
tacaaatgtttagtgtcaaatgccggtggccaggctgtcctgtcagctaatttgaaagtt
attgtacctgaaaatcaagacatagctccaaccttgagcccaatgagagacgttattgtc
ccagaaggtaatgcggctcagttccgcacgcaagtgtcaggacaaccgtcaccgtctgta
caatggtttagagaaggaatacttattcccgaaacaccagattttaaaatgatgtatgaa
ggtaacatggccgtcctgttaataacatcgacatacgaagaagattctggtgtgttcacg
tgtcgagccacaaatagcgctggacaagtagagacctcggccagacttacggtgaaaagt
aagaaataa

DBGET integrated database retrieval system