KEGG   Aphis gossypii (cotton aphid): 114129676Help
Entry
114129676         CDS       T05869                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00020  Citrate cycle (TCA cycle)
ags00480  Glutathione metabolism
ags01100  Metabolic pathways
ags01200  Carbon metabolism
ags01210  2-Oxocarboxylic acid metabolism
ags01230  Biosynthesis of amino acids
ags04146  Peroxisome
Module
ags_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ags_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114129676
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114129676
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114129676
Enzymes [BR:ags01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     114129676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 114129676
NCBI-ProteinID: XP_027850275
Position
Unknown
AA seq 412 aa AA seqDB search
MAKISAGPVVDILGDEMTRIIWDLIKEKLILPFLDIELHVYDLGMENRDLTNDQVTLDCA
EAIKKYNVGIKCATITPDENRVEEFKLKKMWKSPNGTIRNVLGGTVFREAIICKNIPRLV
TGWEKPIIIGRHAHADQYKATDFIVPGAGKLTLTWTSNDGKDKIEEVVNDFKGVGVALGM
FNTDASITDFAHSSFKFALSRELPLYLSTKNTILKKYDGRFKDIFQEIYDTQYKPLYEAK
GIWYEHRLIDDMVAYAMKSEGGFVWACKNYDGDVQSDSIAQGYGSLGLMTSVLICPDGKT
VESEAAHGTVTRHYRMHQQGKETSTNPIASIFAWTRGLLHRAKLDNNQKLEDFANKLEEV
CIETMEAGFMTKDLAICIKGMNGVQRSDYLNTFEFLDKLAENLKLKLNLTCK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcagtgcgggacccgttgttgacattttgggcgatgaaatgactcgcatc
atctgggacttaatcaaggaaaaactcatcctaccgtttttggacatcgaactacatgtt
tatgacttgggcatggaaaaccgagacttgactaacgatcaagtgacattagactgtgcc
gaagccattaagaaatataatgttggaattaaatgcgctacgattacgcccgacgaaaat
cgagtcgaagaattcaagctgaagaaaatgtggaaaagccccaacggcacaattaggaac
gttcttggcggtacagtgttcagggaagctattatatgcaagaacattcctaggctggtt
actggatgggaaaaaccgattataattggaagacacgctcatgctgaccagtataaagct
acagatttcattgtacctggagctggcaaacttacattgacatggacctctaatgatggt
aaagataaaattgaagaagttgtcaacgatttcaaaggtgttggagtagcattaggaatg
tttaacacggatgcatctattactgatttcgcacattcttcattcaagtttgctttatct
agagaacttccattatatttgagtactaaaaataccattttaaaaaaatatgatggtcgt
ttcaaagacattttccaagaaatttatgatacacaatacaaaccattgtatgaagccaaa
ggtatttggtatgaacacagattaattgatgacatggtggcctatgctatgaaatctgag
ggaggatttgtgtgggcgtgtaaaaattatgatggtgatgttcaatctgattctattgcc
cagggttatggatcattgggtttgatgacatcagtgttgatttgccctgatggtaaaact
gttgaatcggaagctgctcatggcactgtcacaagacattatcgtatgcatcaacaaggt
aaagaaacatctactaatccaattgcatctatctttgcatggacaagaggattgttgcat
agagcaaaattggataacaatcaaaaattagaagattttgccaacaaattagaagaagtt
tgcattgaaacaatggaagcaggattcatgactaaagatttggcaatatgcattaaagga
atgaacggtgttcaaagatctgattatctgaatacatttgaatttttggacaaattggct
gaaaatttgaagcttaaattaaatcttacatgcaaatag

DBGET integrated database retrieval system