KEGG   Aphis gossypii (cotton aphid): 114130018Help
Entry
114130018         CDS       T05869                                 

Definition
(RefSeq) very long-chain-fatty-acid--CoA ligase bubblegum-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00061  Fatty acid biosynthesis
ags00071  Fatty acid degradation
ags01100  Metabolic pathways
ags01212  Fatty acid metabolism
Module
ags_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    114130018
   00071 Fatty acid degradation
    114130018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ags01004]
    114130018
Enzymes [BR:ags01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     114130018
Lipid biosynthesis proteins [BR:ags01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   114130018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding FKBP_N_2 Dodecin
Motif
Other DBs
NCBI-GeneID: 114130018
NCBI-ProteinID: XP_027850701
Position
Unknown
AA seq 696 aa AA seqDB search
MSDDGDIIPSVMQNGGNQYKIKENSFLPSAVVENNTKMSFENSKPAENYGPDQVLPASEK
YTSEANGRVTLRIEAGADNTPISVPGLLTRSAELYGDLPALNYKSANKWVKVTYKEYEQN
VRTVAKAFIKLGLERFHGVCIIGFNSPEWFYSDLGAIYAGGFAAGMYTTNLVDACFHCLE
TSKANIAVVEDSKQLEKILSVKSRLPHLKAIIQYEGKPTEEGVLSWEDVMRIGSAESDEK
LNAVLKTMGVNECCTLVFTSGTEGASKAVMVSHDNLTYNAYMITKFLSLVNGKEVLVSYL
PLSHVAAQITDIYSAITLGAQVYFGEKDALKGSLVNTLQAARPTVFLGVPRVWEKINEKL
VSIGRKSGSLKKYIADWAKEVGLNHYEDAMKGVDRETYSYKFFRWLIFSRIKSAIGFDRC
KYFISAAAPITVELKKYFMSLDIPLCEAFGMSECGGAHTLSNPTDENVAGVGKTLEGVRS
KIDKPDKDGNGELCVYGRHVFMGYLNMPDKTEGTLDADGWLHSGDIAQIDDKGYVTITGR
IKELLITAGGENIPPVLIENNVKAALPVVSNAFLIGDKRKFLSILLSLKCEVNAETAEPL
DTLTPEVISWLSSLNCKFTKVSEVVANKPKEVFDAIQKGIDAANKKAISNAQKIQKFTLL
PIDFSLPTGELGPTLKIKRPVVNDKYKDLIEEFYKN
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgacggcgatataattccaagtgttatgcaaaatggtggaaatcaatacaaa
ataaaagaaaattcatttttacctagtgctgttgttgagaataatacaaaaatgagtttt
gaaaactcaaaaccagcagaaaactatgggccagatcaagttttaccagcttcagaaaaa
tatacgagtgaagcaaatggccgagttactttaagaattgaggctggtgcagataatact
cccatatctgtacctggacttttaactagaagtgctgaattatatggagatttacctgct
ttaaattataaatcggcaaataaatgggtcaaagttacttacaaagaatatgaacaaaat
gtaagaactgttgccaaagcatttataaagttgggccttgaaagatttcatggcgtttgt
ataattgggtttaattctccagaatggttttactcagacttgggtgccatttatgctggt
ggttttgctgctggaatgtatacaacaaatctcgtggatgcttgtttccactgtttagag
acaagtaaagcaaatatagctgtagttgaagatagcaaacaattagagaaaatactatca
gtcaaaagtcgtttaccccacttgaaagccattattcaatatgaaggcaaacctactgaa
gagggcgttttatcttgggaagatgtgatgagaattggatcagctgaatctgatgaaaaa
ttaaatgctgtattgaaaactatgggagtcaacgagtgttgtacattagtattcacgtct
ggaactgaaggcgcatcaaaagctgtcatggttagtcatgataatctcacatacaatgca
tacatgatcacaaaatttttgtccttagtcaatggcaaggaagttcttgtatcatattta
cctttaagtcatgtagccgcacaaatcactgatatatatagtgcgatcactttaggggct
caagtatattttggtgaaaaagacgctctaaagggttctttagtgaacacacttcaagct
gctagacctacagtttttttgggtgttcctcgtgtctgggaaaaaattaatgaaaaatta
gtgagtattggccgaaaatcaggttcattgaagaaatacattgctgattgggctaaagaa
gttggcttaaatcattatgaagatgcaatgaaaggagtggatagagaaacatattcgtat
aaattcttcagatggttaatatttagtcgtatcaaaagtgctattggtttcgatagatgt
aaatattttatttcagctgctgctcctataacagtggaactaaaaaaatattttatgagt
ttggatatacctttatgtgaagcatttggaatgtctgagtgcggaggtgcacatacattg
agtaatccaactgacgagaatgtcgctggtgttggaaaaacattagaaggagtcagatca
aaaatcgacaaacctgataaggatggtaatggcgagttgtgtgtttatggacgtcatgtg
tttatgggttatttgaatatgccagacaaaactgagggtaccttagatgctgatggatgg
cttcattctggtgatattgcccaaatagatgataaaggatatgttactattactggaagg
ataaaggaattattaataacagcaggtggagagaacatacctcctgtattgattgaaaat
aatgttaaagctgcattaccagttgttagcaatgctttcttaataggagacaagagaaaa
tttttgtccatactgttatctctaaagtgtgaagtaaatgctgaaaccgctgagccactt
gacactttaacacctgaagtgatttcatggttatcgtcacttaattgtaagtttaccaaa
gtgtcggaggtcgttgcaaacaaacctaaagaagtttttgacgccatacaaaaaggtatt
gatgcagcaaacaagaaagctatatctaatgctcagaaaatccagaagtttacacttctg
cctattgatttctccttgcctaccggtgaattaggtcctacattaaaaatcaagcgtcca
gtagtgaatgataaatacaaagatttaattgaagagttctacaaaaactga

DBGET integrated database retrieval system