KEGG   Agrobacterium sp. 33MFTa1.1: EYD00_20800Help
Entry
EYD00_20800       CDS       T05906                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
agt  Agrobacterium sp. 33MFTa1.1
Pathway
agt00053  Ascorbate and aldarate metabolism
agt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    EYD00_20800
Enzymes [BR:agt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     EYD00_20800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: QBJ15844
Position
linear:1516868..1517665
Genome map
AA seq 265 aa AA seqDB search
MLKRLLITGAGGKLGSMLRGRLGHVAETIRLSDVVDLGSPAPHEEFVRCALEDEQAVYDL
VKDCDGIVHLGGISVERAFDPIEAANLRGVYNLYEAARAHGNPRILFASSNHTIGYYPQG
QQLSPEAPFLPDGLYGVSKIFGEAMASLYHSKFGQETAIVRIGSCDEKPTNWRMLSTWLS
YGDFVSLIEATFRVPKLGCPVIWGVSANDDSWWDNSHVDFLGWQRRDNAARYRAEIERDV
PRPGPEAAIAKYQGGIFIDEPIHRT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcgattgctcatcaccggtgccggcggcaagctgggcagcatgttacgcggg
cggcttggccatgttgccgaaaccatccgtctttctgatgtggttgatctcggttcgcca
gcgcctcatgaagagttcgtccgctgcgcgctggaggacgagcaggcagtttacgatctg
gtcaaggattgcgacggtatcgtccatctcggcggcatttccgtcgagagggcttttgac
ccgatcgaggctgccaatctgcgtggtgtttacaatctttacgaggcggccagagcacac
ggcaatccccgcatccttttcgcctccagcaaccacacgatcggttattacccgcagggg
cagcaacttagccctgaggcgccttttctgcctgatggcctctatggggtttcgaagatt
ttcggcgaggccatggcaagcctctaccattccaaattcggacaggagacggctatcgtg
cgtatcggctcctgtgacgagaaacccacgaactggcgcatgttgtcgacctggctcagc
tacggtgacttcgtctctctcatagaggcgaccttccgcgtgccaaaactcggctgtccg
gttatctggggcgtttcggccaatgacgacagctggtgggataattcccatgtcgatttt
ctcggctggcagcggcgcgacaatgccgcgcgctaccgggctgaaatcgagcgcgacgtc
ccgcgccccggccccgaggcagcgatcgcaaaatatcagggcggcatttttatcgatgag
cccattcacaggacttga

DBGET integrated database retrieval system