KEGG   Aquisphaera giovannonii: OJF2_12020Help
Entry
OJF2_12020        CDS       T06184                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
agv  Aquisphaera giovannonii
Pathway
agv00564  Glycerophospholipid metabolism
agv01100  Metabolic pathways
agv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OJF2_12020
Enzymes [BR:agv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     OJF2_12020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: QEH32723
UniProt: A0A5B9VWG5
Position
complement(1674107..1675366)
Genome map
AA seq 419 aa AA seqDB search
MSHRKAGHRRHRHGRWLPHQDALEDWLEGSCGRASEKAADPATRLQPVVQELKDLIDRDP
IVRMYFTQMIEQVPHAKPYRKRHIEDVDQLLWLIDEVIGRAPEYNETGLVGVPLNAILDW
CMGTPAGFAAFRHEPVNAMFRKILKAWCDFLCSRDSLHVLNDTPRGWKCESARKSTRIDE
FQIDPGDPHWGFSSWNDYFTRKFEPGMRPIAAPDDDRVIVNACESTPYALKTNVRRYDRF
WIKGQPYSLNDMLAGDGSVDEFVGGTVYQAFLDAHNYHRWHSPVSGTVRKAFVVEGTYYS
EAESEGEDPDGPVLSQGYLAHVATRAILLIEADAPSLGLVCLMPIGMVEVSSCVFHPSVK
PGARLRKGDEVGYFQFGGSTYCLIFRPGAIAGFAPEALPQPDNPEPPLVRMGTKIAVAG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcggaaggccggccacaggcgtcatcgtcacggccgctggctgcctcatcag
gacgcgctggaggactggctcgaagggtcctgcggccgagcgtccgagaaggcggccgac
ccggcgacgcggctgcagcccgtcgtgcaggagttgaaggacctcatcgaccgcgacccg
atcgtccggatgtacttcacgcagatgatcgagcaggtgccgcatgccaagccgtaccgc
aagcggcacatcgaggacgtcgaccagctcctctggctgatcgacgaggtcatcggccgc
gccccggaatacaacgagaccgggctggtgggcgtgccgctgaacgcgatcctcgactgg
tgcatgggcacgccggccggcttcgcggccttccgccacgagccggtcaacgccatgttc
cggaagatcctgaaggcctggtgcgacttcctgtgcagccgcgattcgctccacgtcctg
aacgacacgccccgcggttggaaatgcgaatcggccaggaagtccacgcggatcgacgag
ttccagatcgatccgggcgacccccactggggcttctcctcctggaacgactacttcacc
cgcaagttcgagcccggcatgcggccgatcgccgcgcccgacgacgaccgggtcatcgtg
aatgcctgcgagtccacgccgtacgccctgaagacgaacgtccggcggtacgaccgcttc
tggatcaagggccagccgtactcgctgaacgacatgctggcgggcgacggctcggtcgac
gagttcgtcggggggacggtgtaccaggctttcctggacgcccacaactaccaccgatgg
cacagcccggtctccgggacggtccggaaggccttcgtggtcgaggggacgtattactcg
gaggccgagtccgagggcgaggatcccgacggcccggtgctctcgcagggttacctcgcc
cacgtggcgacccgcgcgatcctcctgatcgaggccgacgccccgtcgctcggcctcgtc
tgcctgatgccgatcgggatggtcgaggtctcctcgtgcgtcttccacccctccgtcaag
ccgggcgcccggctgaggaagggggacgaggtcggctacttccagttcggcggatcgacg
tattgcctgatcttccgcccgggggcaatcgccggcttcgcccccgaggcgctgccgcag
ccggacaacccggagcccccgctggtgcggatggggacgaagatagccgtggcaggctga

DBGET integrated database retrieval system