KEGG   Aquisphaera giovannonii: OJF2_52050Help
Entry
OJF2_52050        CDS       T06184                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
agv  Aquisphaera giovannonii
Pathway
agv00430  Taurine and hypotaurine metabolism
agv00620  Pyruvate metabolism
agv00640  Propanoate metabolism
agv00680  Methane metabolism
agv01100  Metabolic pathways
agv01120  Microbial metabolism in diverse environments
agv01200  Carbon metabolism
Module
agv_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:agv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OJF2_52050 (ackA)
   00640 Propanoate metabolism
    OJF2_52050 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    OJF2_52050 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    OJF2_52050 (ackA)
Enzymes [BR:agv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     OJF2_52050 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QEH36620
UniProt: A0A5B9W9U9
Position
complement(6830239..6831444)
Genome map
AA seq 401 aa AA seqDB search
MKILVANLGSTSFKYRLFDVSDPSEPVLARGGIERIGSPTARVVVKTTRGERESARHVED
HGDAVQLCLEQLTDPEIGVLADPSEVSAIGFKAVHARNLTGVHLVDDEVLAAMEAFADVA
PAHNPPYTKAMRMLRGRFPKLPLVAAFETGFHRTIPEARQRYAIPDAWATELGIRKWGFH
GASHRYISWRVPELLGRKDLKVISCHLGGSSSLAAIDSGRSVACSLGMSPQTGLPHNNRV
GEFDVFALPPLLRETGKTLEEILDILANQSGLQGLCEARDLRDIEAAADKGDPCAKLAID
VFVDSIRHYLGAFMVALGGLDVIAFTGGIGENSSRIREEVCRDLAWFGIELDPTLNASGE
AERKVSSAGSRVQVWTVPTNEELVVARQSRTLLDSGKASMD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcctcgtcgccaacctcggctccacgagcttcaagtaccgcctcttcgacgtg
agcgacccgtccgagccggtcctggcccggggcggcatcgagcggatcggctcccccacc
gcccgcgtcgtcgtcaagacgacgcggggcgagcgggaatcggcccgccacgtcgaggac
cacggcgacgccgtccagctctgcctggagcagctgaccgacccggagatcggcgtcctc
gcggacccctccgaggtctcggccatcggcttcaaggccgtgcacgcccgcaacctgacc
ggcgtccacctcgtggacgacgaggtgctggcggcgatggaggccttcgcggacgtggcc
cccgcccacaaccccccgtatacgaaggccatgcggatgctccggggccgcttcccgaag
ctccccctagtcgcggccttcgagaccggcttccaccggaccatcccggaggcccgccag
cgctacgccatcccggacgcctgggccaccgagctgggcatccggaagtggggcttccac
ggggccagccaccgctacatctcgtggcgggtgccggagctcctgggcaggaaggacctg
aaggtcatctcctgccacctcggcggcagctcctcgctcgccgccatcgactccggccgg
tcggtcgcctgcagcctcgggatgagcccccagaccggcctgccgcacaacaaccgcgtc
ggcgagttcgacgtcttcgccctgccccccctgctccgcgagacgggcaagacgctggag
gaaatcctcgacatcctggccaaccagtccgggctccagggcctctgcgaggcccgggac
ctgcgggacatcgaggcggccgccgacaagggcgacccctgcgcgaagctggccatcgac
gtcttcgtggactcgattcgccactacctcggggcgttcatggtcgccctcggcggcctg
gacgtcatcgccttcaccggcgggatcggcgagaactcgtcgcggatccgcgaggaggtc
tgccgcgacctggcctggttcggcatcgagctcgacccgacgctcaacgcctccggcgag
gccgagcgcaaggtgtcctcggctggctccagggtccaggtctggaccgtcccgacgaac
gaggagctggtcgtcgcccgccagagccggacgctgctcgactcgggcaaggcgtcgatg
gactga

DBGET integrated database retrieval system