KEGG   Agromyces aureus: ATC03_03645Help
Entry
ATC03_03645       CDS       T04413                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
agy  Agromyces aureus
Pathway
agy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:agy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ATC03_03645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:agy02000]
    ATC03_03645
Enzymes [BR:agy01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     ATC03_03645
Transporters [BR:agy02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    ATC03_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 ABC_ATPase AAA_23 AAA_30 MMR_HSR1 AAA_16 AAA_22 AAA_27 AAA_25 Zeta_toxin DUF815 DUF2813 AAA_15 ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ANJ25964
UniProt: A0A191WCQ5
Position
870760..872391
Genome map
AA seq 543 aa AA seqDB search
MSEALPIVEMRDISIEFPGVKALDGVDFRLFQGEVHALMGENGAGKSTLIKALTGVYKID
GGSIVVAGQERQFHGTRDAQSAGVSTVYQEVNLVTNLSIGENVMLGHEIRGAIGVNWRAT
HAAATEALARLGLEHLDTHKPLSTLSIAMQQLVAISRAMAIQAKVLILDEPTSSLDAAEV
EGLFRVMRSLRDQGVAILFVSHFLDQIYAISDRLTILRNGKYEGEYLTRDLDRHALISKM
IGKDLGALSSLGGNRRVDDRDYAAEEPLLTAKGLGRRGSIEPTDLDVHRGEVVGFAGLLG
SGRTELARLLYGADRADEGEVTLHGKRVDIKSPADGLVKRIAFSTENRRDEGIIADLTVR
ENMILAVQAERGWARPIPRKEQDELVEKYITALNVRPSDPNRLIKNLSGGNQQKVLLGRW
LATNPELLILDEPTRGIDVGAKAEIQEAVAELAESGVSVVFISSELEEVVRLSERIVVLK
DHQKIGEIVNGPEITAQHVVDVIAAHGVEAAAESGIIDAEAGLHPTEAPHANAHALAATE
EES
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcactgccaatcgtggagatgcgcgacatctccatcgagttcccaggcgtc
aaagccctcgacggggtggacttccgcctcttccagggcgaggtccacgcgctgatgggc
gagaacggcgccggcaagtcgacgctgatcaaggccctcaccggggtctacaagatcgac
ggcggctcgatcgtcgtcgcgggccaggagcgtcagttccacggcacccgcgatgcgcag
agcgccggcgtctccaccgtgtaccaggaggtcaacctggtcacgaacctctcgatcggc
gagaacgtcatgctcggccacgagatccgcggggcaatcggcgtgaactggcgtgcgacg
cacgccgccgccaccgaggcgctcgcccgactcgggctcgagcacctcgacacccacaag
ccgctctcgacactgtcgatcgccatgcagcagctcgtcgcgatcagccgggccatggcg
atccaggcgaaggtgctcatcctcgacgagccgacctcgagcctcgacgcggccgaggtc
gagggcctgttccgcgtgatgcgctcgctccgcgaccagggcgtcgccatcctcttcgtc
tcgcacttcctcgaccagatctacgcgatcagcgaccgcctgacgatcctgcgcaacggc
aagtacgagggcgagtacctcacccgcgacctcgatcgccacgcgctcatctcgaagatg
atcggcaaggacctcggggcgctgtcgtcgctcggcggcaaccgccgcgtcgacgaccgc
gactacgccgccgaggagccgctgctcacggcgaagggcctcggccgtcgcggctcgatc
gagcccaccgatctcgacgtccaccgcggcgaggtcgtcggcttcgccggcctcctcggc
tccggccgcaccgagctcgcacgcctgctctacggcgcagatcgcgccgacgagggcgag
gtcacgctgcacggcaagcgcgtcgacatcaagagccccgccgacggcttggtcaagcgc
atcgcgttctcgaccgagaaccggcgcgacgagggcatcatcgccgacctcaccgtgcgc
gagaacatgatcctcgcggtgcaggccgagcgcggctgggccaggcccatcccgcgcaag
gaacaggacgagctcgtcgagaagtacatcaccgccctgaacgtgcggccctccgatccg
aaccggctcatcaagaacctctccggcggcaaccagcagaaggtgctgctcggccgctgg
ctcgcgacgaatcccgagctgctgatcctcgacgagcccacccgcggcatcgacgtcggc
gcgaaggccgagatccaggaggccgtcgccgaactcgccgagagcggcgtctcggtcgtc
ttcatctcctccgagctcgaggaggtcgtgcgcctcagcgagcgcatcgtcgtgctgaag
gaccaccagaagatcggcgagatcgtcaacggccccgagatcacggcccagcacgtcgtc
gacgtcatcgccgcgcacggtgtcgaggcggccgccgagagtggcatcatcgatgccgag
gcgggtttgcacccgaccgaggccccgcacgcgaacgcgcatgcgctcgctgcgacggag
gaggaatcatga

DBGET integrated database retrieval system