KEGG   Agromyces aureus: ATC03_10315Help
Entry
ATC03_10315       CDS       T04413                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
agy  Agromyces aureus
Brite
KEGG Orthology (KO) [BR:agy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:agy03009]
    ATC03_10315
Enzymes [BR:agy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ATC03_10315
Ribosome biogenesis [BR:agy03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    ATC03_10315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 MTS PCMT Methyltransf_12 Ubie_methyltran NHL Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ANJ27060
UniProt: A0A191WFJ7
Position
2329166..2330035
Genome map
AA seq 289 aa AA seqDB search
MSFDTTWFRCPNCFSVLSPTGDLVIGCANGHRFDVARQGTVTLLPPRAPRTVGDDHAMLT
ARAALLDSALYVPIADAIVELAELNLAPLAADDTGPRLVDFGCGTGYYAARVEERVRASA
VLLADRSPVAVRLATRGISGATGVVLDIWRPLPLRDASADLALNVFAPRNPEEYARVIKP
GGILVVVVPRENHLAELRCDGSVLTVPADKERLVTETLGAAGFGLADRRHVEYSEPVSSE
QRAHLVAMGPSAHHAGEPALTDAGGLEGATAAPVGSPVTISVDVLAFRR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgacacgacctggttccggtgcccgaactgcttctccgtactgtccccgacc
ggcgacctcgtgatcggatgcgcgaacggccatcggttcgacgtggcacgtcagggcacg
gtcaccctcctccccccgcgggccccgcgcacagtgggcgacgaccacgcgatgctgacg
gctcgagcagccttgctcgattcggcgctgtacgttccgatcgccgatgcgatcgtcgag
ctcgccgagctgaatctcgcgccgctcgccgctgacgacaccggacctcgtctcgtggac
ttcggatgcggcaccggctactacgcagcgcgcgtggaggagcgagtgagagcgagtgcg
gtgctcctcgctgatcgctcgcccgttgccgtgcgactggccacccgagggatctccggc
gccactggtgtcgtgctcgacatctggcgtccactccccctgcgcgacgcctccgccgat
cttgccctcaacgtcttcgcgccgcgcaatcccgaggagtacgcgcgcgtgatcaagccc
ggaggcatcctcgtggtcgtcgtgccccgcgagaaccacctggcggagctcaggtgcgac
ggctccgtcctcacggtacccgcagacaaggagcgactcgtcaccgagacgctcggcgcg
gccggcttcggtcttgccgatcggaggcatgtcgagtactcggagcccgtcagctccgag
cagcgcgcgcacctcgtcgccatgggcccatctgcccaccatgcgggcgaaccagccctg
acggacgccggcgggctcgagggcgcaaccgcagcgccggtcggttcgccggtgacgatc
tccgtcgacgtgctcgccttccgacgctag

DBGET integrated database retrieval system