KEGG   Agromyces aureus: ATC03_14855Help
Entry
ATC03_14855       CDS       T04413                                 

Definition
(GenBank) hypothetical protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
agy  Agromyces aureus
Pathway
agy00562  Inositol phosphate metabolism
agy00564  Glycerophospholipid metabolism
agy00565  Ether lipid metabolism
agy01100  Metabolic pathways
agy01110  Biosynthesis of secondary metabolites
agy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ATC03_14855
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ATC03_14855
   00565 Ether lipid metabolism
    ATC03_14855
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ATC03_14855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:agy02042]
    ATC03_14855
Enzymes [BR:agy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ATC03_14855
Bacterial toxins [BR:agy02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ATC03_14855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase TAT_signal UCR_Fe-S_N VD10_N
Motif
Other DBs
NCBI-ProteinID: ANJ27799
UniProt: A0A191WHZ8
Position
complement(3335584..3337332)
Genome map
AA seq 582 aa AA seqDB search
MTEERDSNPTHGGPSRRDFLRFGGTAAAGAVVGGAAGYAAASAQGGTTPPAGGPDESTPS
PSLPPRAAGAGFDHLVVVMFENRSFDNLLGYLYAESGPPPGQQYAGFNEGLPSNPDHEGR
QIAVHPYTGSTDEIMSSPRPDPGEDYPHVNTQLFGTVRPSGNAHQQVAKMKKPFNAPVDD
GSPTMDGFVKDYLNNFVAEEGRSPKAQEAEVAMGAFAPDMLPVLTALARGFAVFDHWHCA
VPGPTFCNRSFFHASTSHGFVTNHDNGGYKKWHDKKVASPTIFNRLEDAGIPWAVYYDDS
QLVSMTGFIHKPVLEQFWKTRFFPMSTFYQACSDGTLPAYAFIEPRMIYDHNDMHPPVGT
TDTKDVDGKDVAGGAISDVRAGEALLHRIYTAVRDGGTAEGSNAVNTTLLVTFDEHGGTF
DHVVPPSATPPDDSGPGEMGFEFDRLGLRVPAIAISAYAAASSVVNSAAHHGTVISTLCG
KYQLESLTARDAGAPTLDDALTLATPRQPSTWPATLPQYIPRNPESDPVPAGQDDRPLSP
PGRGLMGMLAAYVGSEGDLPKTFRQAHDFLEQHGRGLFGPGS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggaacgtgattcgaaccccacccatgggggcccctcccggcgcgatttcctg
cggttcggaggaaccgccgccgcaggcgcggtcgtcgggggcgctgccgggtacgccgcg
gcatccgcccagggtgggacgacgccgccggccggcgggccggatgagagcacgccctcg
ccctcacttccgccgcgcgccgcgggcgcaggattcgatcacctcgtcgtggtgatgttc
gagaaccgttcgttcgacaacctgctcgggtacctctacgccgagtcgggcccgccgccg
ggccagcagtatgccggattcaatgaagggctgccgtccaaccccgatcacgaaggccgg
cagatcgccgtgcacccgtacaccggatcgaccgacgagatcatgtcgagcccgcggccc
gacccgggcgaggactacccgcacgtcaacacgcagctcttcggcacggtcaggccttcg
ggcaatgcccaccagcaggtcgccaagatgaagaagccgttcaacgcacccgtcgacgac
ggttcccccacgatggacggattcgtgaaggactacctgaacaacttcgtcgccgaagag
ggtcgctcgcccaaggcgcaggaggcggaggtcgcgatgggcgcgttcgcccccgacatg
ctgccggtgctgacggccctcgcgcgcggcttcgcggtgttcgaccactggcactgcgcc
gtgccgggacccacgttctgcaatcgctcgttcttccatgcctcgacctcccacgggttc
gtgacgaatcacgacaacggcggctacaagaagtggcatgacaagaaggtcgcatcgccc
acgatcttcaaccggctcgaggacgccggcatcccgtgggccgtctactacgacgactcg
cagctggtgtcgatgacgggcttcatccacaagccggtgctcgagcagttctggaagacc
cgattcttcccgatgagcacgttctaccaggcctgctccgacggcacgctgccggcgtac
gccttcatcgaaccccgcatgatctacgaccacaacgacatgcatccgccggtgggcacc
accgatacgaaggacgtcgacggcaaggatgtcgctggtggggcgatctccgatgtccgt
gccggcgaggcactgctgcatcgcatctacacggcggtgcgcgacggcggcaccgccgag
gggtcgaacgcggtgaacacgacgctcctcgtgaccttcgacgagcacggcggcacgttc
gatcacgtggtccctcccagcgcgaccccgcccgacgacagcgggccgggcgagatgggc
ttcgagttcgaccggctcggcctgcgcgtgccggccatcgccatctccgcgtacgccgcg
gcgagctcggtcgtgaactccgccgcccaccacggcaccgtgatcagcacgctgtgcggc
aagtaccagctcgaatcgctcacggcgagggacgccggtgcgccgaccctcgacgacgcc
ctcaccctcgcgaccccgcggcagccgtccacctggccggccaccctgccgcagtacatc
ccgcgcaaccccgagtcggaccccgtgccggcaggccaggacgaccgcccgctgagcccg
cccggtcgaggtctcatgggcatgctcgccgcgtacgtcggcagcgaaggcgacctgccg
aagacgttccgccaggcccacgacttcctcgagcagcacgggcgcgggctcttcgggccc
ggcagctga

DBGET integrated database retrieval system