KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2856
Entry
AHA_2856          CDS       T00424                                 

Name
(GenBank) pyruvate formate-lyase
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABK39354
UniProt: A0KM59
Position
3205304..3207736
AA seq 810 aa
MTQLDLTTLPPRIRAHKESLIHIVQPPVCTERARHYTQAYQAHLARPLPVRRALALALHL
KERTIWIKHDELIVGNQASQVRAAPLFPEYTVGWIEKEIDELADRPGAGFAVSEADKLAI
HALTPFWNGQTVQDRCYGLFTDEQKGLLESGIIKAEGNMTSGDAHLAVNYEQLLALGLDG
LKAKVAERCGRLDLADWADLQREQFLQAVAITFDAVSQHIERYAALARELAQQEPRPERR
CELETIALNCAHIAHRPPETFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPWYRRE
VELSESLPRTRAIELLQGCWLKLLEVNKIRSGTHSKASAGSPLYQNVTIGGQNWRDGKAH
DAVNGLSYAILESCGQLRSTQPNLSVRYHAGMSEDFLDACIQVIRCGFGMPAFNNDEVVI
PEFIKLGVSEEDAHHYAAIGCIETAVPGKWGYRCTGMSFINFARILLAALDGGRDATTGK
VFLPQPQSLRQGTFGHFDEVMARWDEQVRYFTRKSIEIDCVVDSVLEAQAHDILCSALVD
DCIERGKTIKQGGAVYDWVSGLQVGIANLGNSLAALKKLVFEQGVVDQRELAEALEQDFA
GLEGEQLRQRLTHAAPKYGNDLDEVDLLLVQAYQSYIDELKGLHNTRFGRGPIGGTYYAG
TSSISANVPFGAATMATPDGRHARTPLAEGASPASGSDRLGPTAVFNSLGKLPTAAILGG
VLLNQKLSPASLENERDKTKLMSLLRTFFEVHKGWHVQYNIVSRETLLAAKAHPDQYRDL
VVRVAGYSAFFTALSPDAQDDIIARTEHSL
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgacccagctcgacctcactaccctgcccccgcggatccgtgcccacaaggagagcctg
atccacatcgtccagccgccggtctgcaccgagcgtgcccgtcactacacgcaagcctat
caggcccatctggcccggccgctgccggtgcgccgcgccctggcgctggccctccacctc
aaggagcgcaccatctggatcaagcacgacgagctcatcgtcggcaaccaggccagtcag
gtgcgggcggcgccgctctttcccgaatacacggtgggctggatcgagaaggagatcgac
gagctggccgaccgccccggcgccggctttgcggtgagcgaggcggacaagctggccatc
cacgccctcacccccttctggaacggccagacggtgcaggatcgctgctacggcctcttt
accgacgagcagaaggggctgctggagagcggcatcatcaaggccgagggcaacatgacc
tcgggggatgcgcacctcgcggtcaactacgagcagctgcttgccctcggtctcgacggc
ctcaaggccaaggtggccgagcggtgcggccggctcgatctggcggactgggccgatctg
cagcgcgagcagttcctgcaggccgtcgccatcaccttcgatgccgtcagccagcacatc
gagcgttacgccgcactggctcgcgaactggcacagcaggagccgcgccccgagcgccgc
tgcgagcttgagaccatcgccctcaactgcgctcacatcgcccaccggccccccgagacc
ttctggcaggcgctgcagctctgctacttcatccagctcatcctgcagatcgagtccaac
ggccactcggtgtcgtttggccggatggaccagtacctctacccctggtatcgccgcgaa
gtagagctgtcggaatccctgccgcgcacacgcgccatcgagctgctgcaagggtgctgg
ctcaagttgctggaggtgaacaagatccgctccggcacccactccaaagcctccgccggc
agcccgctctatcaaaacgtcaccatcggcggccagaactggcgggatggcaaagcccat
gacgcggtcaacggcctctcctacgcgattctggagtcctgcggccagctgcgctccacc
cagcccaacctctcggtgcgctaccacgccggcatgagcgaggatttcctcgacgcctgc
atccaggtgatccgctgcggcttcggcatgcccgccttcaacaacgacgaggtggtgatc
cccgagttcatcaagctcggggtgagcgaggaggatgcccaccactacgccgccatcggc
tgcatcgagactgcagtacccggcaagtggggctatcgctgcaccggcatgagcttcatc
aacttcgcccgcattctgctggcggcactcgatggcggccgcgatgccaccaccggcaag
gtcttcctgccccagccccagtcactgcggcaaggcacgttcggccacttcgacgaggtg
atggcccgctgggacgagcaggtgcgctacttcacccgcaaatccatcgagattgactgc
gtggtcgacagcgtgctggaggcccaggcccacgacatcctctgcagcgccctggtggat
gactgcatcgagcgcggcaagaccatcaagcaggggggcgccgtctatgactgggtctcc
ggattgcaggtggggatcgccaacctgggcaacagcctggcggcgctgaagaaactggtg
ttcgagcagggcgtggtggatcagcgcgagctggccgaagcgctcgagcaggattttgcc
gggctcgagggcgaacagctgcgccagcgcctcacccacgcagcccccaaatatggcaac
gatctggacgaggtcgacctgctgctggtgcaggcctaccagagctacatcgacgagctc
aaggggctgcacaacacccgcttcggccgtggccccatcggtggcacctactatgcgggc
acctcctccatctcggccaacgtgccgtttggggcggccaccatggctaccccggatggc
cgccacgcccgcaccccgctggcggaaggggccagcccagcatcgggctcggatcgcctc
ggccccacggcggtgttcaattcgctcggcaagctgcccacggcggccatcctcggcggc
gtgctgctcaaccagaaactgagcccggccagccttgaaaacgagcgggacaagaccaag
ctgatgagcctgctgcgcaccttcttcgaggtgcacaaggggtggcacgtgcagtacaac
atcgtctcgcgggaaaccctgctggcggccaaggcccatcccgaccagtatcgggatctg
gtggtgcgggtggcgggctattcggccttcttcaccgccttatcccccgatgcgcaagat
gatatcatcgcccgcaccgagcacagtctctga

DBGET integrated database retrieval system