KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0043Help
Entry
AHA_0043          CDS       T00424                                 

Gene name
kdkA
Definition
(RefSeq) 3-deoxy-D-manno-octulosonic acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AHA_0043 (kdkA)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     AHA_0043 (kdkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo APH RIO1 Pkinase Kinase-like Choline_kinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 4490263
NCBI-ProteinID: YP_854568
UniProt: A0KEC7
Position
46888..47601
Genome map
AA seq 237 aa AA seqDB search
MQIQTEHNQICWYAEGAFRDPSPELFDPAWWQTHRQVVGSSIGRGVTWFVKDESRHLVLR
HYYRGGMVGKVVRDRFWFEGVESSRAMAEYTLLAKLSAQGLPVPRPFAARMAKQGPFYRA
DILIERIRGAKDLVALLKQGPIAGEVWHKVGQTVRRLHDAGVYHADLNSHNLLLDKEGKV
WVIDFDKGAIRSPGNWQQANLERLLRSFNKESQLHTSFHFVPENWQALMNGYQGKAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcagaccgaacacaaccagatctgctggtacgccgaaggggcgtttcgcgac
ccttctcccgagctgtttgatccggcctggtggcagacacatcgccaggtggtagggtct
tccatcggccgcggagtgacctggttcgtcaaggatgaatcccgccatctggtgctgcgt
cactactatcgcggtggcatggtgggcaaggtggtgcgggatcgcttctggttcgagggg
gtcgaatcgagccgtgccatggccgaatacacgctgctggccaagttgagcgcccaggga
ttgccggtgccgcgcccgtttgccgcccggatggccaagcagggccccttctatcgggcc
gacatcctgatcgagcgcattcgcggcgccaaggatctggtggccctgctcaagcagggg
ccgatcgccggcgaggtgtggcacaaggtgggccagacggtgcgccggttgcacgacgcc
ggggtctatcacgccgatctcaacagccacaacctgctgctcgacaaggagggcaaggtg
tgggtgatcgacttcgacaagggggccatccgctctcccggcaactggcagcaggccaac
ctggaacggttgctgcgctccttcaacaaggagtcccagttgcataccagtttccatttc
gtgccggagaactggcaggccctgatgaacggctatcaaggaaaagcgagctga

DBGET integrated database retrieval system