KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0323Help
Entry
AHA_0323          CDS       T00424                                 

Gene name
rpsH
Definition
(RefSeq) 30S ribosomal protein S8
  KO
K02994  small subunit ribosomal protein S8
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aha00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AHA_0323 (rpsH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aha03011]
    AHA_0323 (rpsH)
Ribosome [BR:aha03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    AHA_0323 (rpsH)
  Archaea
    AHA_0323 (rpsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S8
Motif
Other DBs
NCBI-GeneID: 4489528
NCBI-ProteinID: YP_854857
UniProt: A0KF35
Position
342167..342559
Genome map
AA seq 130 aa AA seqDB search
MSMQDPIADMLTRIRNGQAASKVAVSMPSSKLKVAIAKVLKEEGYITGYSVAGDVKPELE
IELKYFQGKPVVELIQRVSRPGLRIYKRTTDLPKVMGGLGVAIVSTSKGVMTDRAARKAS
MGGEIICYVA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaagatccgatcgcggatatgctgacccgcatccgtaacggtcaggcggcg
agcaaagttgcggtttccatgccttcttccaagctgaaagtggctatcgccaaagtgctg
aaagaagaaggttacatcactggctactccgtagctggtgacgtgaagccggaactggaa
attgaactgaaatatttccagggcaagccagttgtagaactgatccaacgcgtgagccgt
cccggcctgcgtatttacaagcgcactactgatctgccgaaagttatgggcggtctcggt
gttgctatcgtgtccacgtctaaaggtgtgatgactgaccgtgctgcccgcaaagcaagc
atgggcggtgagatcatctgctacgtcgcttaa

DBGET integrated database retrieval system