KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0766Help
Entry
AHA_0766          CDS       T00424                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00260  Glycine, serine and threonine metabolism
aha00750  Vitamin B6 metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01230  Biosynthesis of amino acids
Module
aha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHA_0766
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AHA_0766
Enzymes [BR:aha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AHA_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 4488119
NCBI-ProteinID: YP_855307
UniProt: A0KGB8
Position
complement(818609..819820)
Genome map
AA seq 403 aa AA seqDB search
MPYSYLSHLRCSKTGEIVDADQPQQLSPVGAPLLASYDLEALKQAWHPAALLGRPASLWR
YHELLPVRDPAQVVTLGEGFTPLLPLPRLGKQVGIPDLWMKDESLTPTGSFKARGAAVGV
SRARELGLTHFAMPTNGNAGAAWALYGARAGLRSTIVQPQAAPAITRLESALAGARLYLV
DGLISDAGRQVAEAVAQQGLFDASTLKEPYRIEGKKTMGFEIAEQLGWTLPDVILYPTGG
GVGLIGIYKALRELQELGWVQGPLPRLVAVQASGCAPIVQAWQQGERESRFWPDSQTLAF
GINVPKALGDFLVLDALYRTEGCAIAVEDGAIQRELRQLASQEGCFVCPEGAAAFAAARQ
LREAGWIQGGERVVVLNTGAGIKYPDAITVVPQRLRRDGRIPA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacagctacctatcacatctgcgttgcagcaagaccggcgagattgtggatgcc
gatcagccccagcagctgagcccggtcggcgcccccttgctggccagctacgacctcgag
gccctgaagcaggcctggcatccggccgccctgctggggcgccccgccagcctgtggcgc
taccacgagctgctgccggtgcgcgaccccgcccaggtggtcaccctgggggaaggcttc
accccgctgttgccgctgccgcgcctcggcaaacaggttggcattccggatctctggatg
aaggatgagagcctcacccccaccggctccttcaaggcccgcggcgccgcggtcggcgtc
tcccgcgcccgcgaactcggcctcacccacttcgccatgcccaccaacggcaacgccggc
gcggcctgggcactctacggcgcccgcgccggcttgcgcagcaccatagtccagccgcaa
gcggcccccgccatcacaagactggagagcgccctggccggtgcccgcctctatctggtg
gacggcctcatcagcgacgccggtcgccaggtggccgaggcggtggcgcagcaggggttg
tttgatgcctccaccctcaaggagccctatcgcatcgagggcaagaaaaccatggggttt
gaaatcgccgagcagcttggctggaccctgccggacgtgatcctctaccccaccggcggc
ggggtcggcctcatcggcatctacaaggcgctgcgggagttgcaggagctaggctgggtg
caggggccgctgccgcgactggtggcggtgcaggcgagcggctgcgcccccatcgtccag
gcctggcagcagggggagcgcgaatcgcgcttctggcccgactcccagaccctggcgttc
ggcatcaacgtacccaaggcgctgggggattttctggtgctggatgccctctatcgcacc
gagggctgcgccatcgcggtggaagacggcgccatccagcgcgagctgcgtcaactcgcc
tcccaggagggctgcttcgtctgcccggaaggggcggccgccttcgcagccgcccgccag
ctgcgggaagcgggctggatccaggggggcgagcgggtggtggtgctcaacactggcgcc
ggcatcaagtacccggacgccatcacggtcgtgccccagcggctgcgccgcgacgggagg
atcccggcatga

DBGET integrated database retrieval system