KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1436Help
Entry
AHA_1436          CDS       T00424                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00020  Citrate cycle (TCA cycle)
aha00480  Glutathione metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
aha01210  2-Oxocarboxylic acid metabolism
aha01230  Biosynthesis of amino acids
Module
aha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aha_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHA_1436 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AHA_1436 (icd)
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AHA_1436 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh MJ1316 Phage_SSB
Motif
Other DBs
NCBI-GeneID: 4490622
NCBI-ProteinID: YP_855975
UniProt: A0KI74
Position
1571429..1572682
Genome map
AA seq 417 aa AA seqDB search
MESKVVIPTQGQKITVDANGKLQVPNHPIIPFIEGDGIGVDVTPAMLNVVNAAVEKAYKG
ERKIAWMEIYTGEKSTHVYGEGAWLPAETLDFIREYCVAIKGPLTTPVGGGIRSLNVALR
QELDLYICLRPVRYYEGTPSPVKRPDLTDMVIFRENAEDIYAGIEWKADSDEAKKVIAFL
QNEMGVKKIRFPETCGIGIKPMSKAGTERLVRAAIEYAIDNDRDSVTLVHKGNIMKFTEG
AFKDWGYALAQKEYDAQLIDGGPWCSFKNPKTGKTIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDGVALFEATHGTAPKYAGQDKVNPGSLILS
AEMMLRHMGWTEAADLIIKGMEAAIRNKTVTYDFERLMEGATLRSCSQFAQDMVDQM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttatcccgacccagggtcaaaaaatcacagtcgatgccaacggc
aagctgcaggttcccaaccatccgatcattccgtttatcgaaggggatggcatcggtgtg
gacgtgaccccggccatgttgaatgtggtgaatgccgcggtcgagaaagcctacaaaggc
gagcgcaagatcgcctggatggagatctacaccggcgagaagtcgactcatgtctatggc
gaaggtgcctggctgccggccgaaaccctggatttcattcgtgaatactgcgtggccatc
aagggcccgctgaccaccccggtcggcggcggtattcgctccctcaacgttgccctgcgc
caggagctggatctctacatctgcctgcgtccggtccgttactacgagggcaccccgagc
ccggtcaagcgtcctgatctgaccgacatggtgatcttccgcgagaacgccgaagacatc
tacgccggcatcgagtggaaagccgacagcgacgaagccaagaaggtgatcgccttcctg
caaaacgagatgggcgtgaagaaaattcgcttccccgagacctgcggcatcggcatcaag
cccatgtccaaggccggtaccgagcgtctggtccgtgccgccatcgagtatgccatcgac
aacgatcgtgactccgtgaccctggtacacaagggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctacgccctggcccagaaagagtacgatgcccagctcatcgac
ggcggcccctggtgctccttcaagaacccgaaaaccggcaagaccatcgtggtcaaggac
gtcattgccgacgccttcctgcaacagatcctgctgcgcccggccgagtatgacgtcatc
gcctgcatgaacttgaacggcgactacatctccgacgcgctggcggcccaggtgggcggc
atcggcatcgcaccgggtgccaacatcggtgacggcgtggccctgttcgaagcaacccac
ggcaccgcgccgaaatatgccggtcaggacaaggtcaacccgggctctctcatcctctcc
gccgagatgatgctgcgtcacatgggctggaccgaagcggccgatctcatcatcaagggg
atggaagcggcgatccgcaacaagaccgtcacttatgacttcgagcgtctgatggaaggc
gccaccctgcgctcctgctcccagttcgcccaggacatggtcgaccagatgtaa

DBGET integrated database retrieval system