KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1668Help
Entry
AHA_1668          CDS       T00424                                 

Gene name
malF
Definition
(RefSeq) maltose transporter membrane protein
  KO
K10109  maltose/maltodextrin transport system permease protein
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha02010  ABC transporters
Module
aha_M00194  Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:aha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AHA_1668 (malF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aha02000]
    AHA_1668 (malF)
Transporters [BR:aha02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194]
    AHA_1668 (malF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MalF_P2 BPD_transp_1 TM_PBP2_N
Motif
Other DBs
NCBI-GeneID: 4490951
NCBI-ProteinID: YP_856204
UniProt: A0KIV3
Position
1821823..1823475
Genome map
AA seq 550 aa AA seqDB search
MEVVPSIESYAGPKDKHTWLKWTIAALVAILNGYAAVMMYASGEWVFALLDLVVVSVGLY
VFMNKKTYAHRYIFPGVAGMVVFIIFPLAYTIGIAFTNYSGSNLLSIEQARDYHLKKTYK
VAGGEFDFTLLGGENNQFQLLLKQDDQSFISQPVTLMSNKARELAVREGRVHEPVQVVQL
QHLEGEAVDKVAPIRAIVDHRTHLSALDLVLPDGGTHLTLSSLRKFAAQKQQYTRLLDGA
VLKSGVVIKDSNLLRDNQSGELMLPNGDTGFYQYIDEQGQFVGKSVAPGFVVSVGWKNFA
RIVTDPGIQAPFLQIFIWTVIFSACSVGFTLAIGMVLACLVQWESLKGRGFYRVMLILPY
AIPAFISILVFKGLFNQNFGEINLFLEAAFGIKPDWYTNPFLAKVMILIVNTWLGYPYMM
ILCMGLLKAIPEDLYEASAMDGAGPVQNFFKITVPLLMKPLTPLLIASFAFNFNNFVLIQ
LLTNGAPDIIGASTPAGTTDLLVSYTYRIAFQGSGGQDYGLASAIATAIFLIVGALALLN
LKLSKADKQL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagtaccttctattgaatcctatgccggtccgaaggataagcacacctggctt
aagtggaccattgctgctctggtagccatcctcaacggttatgcagccgtgatgatgtac
gccagcggtgagtgggtattcgctctgctggatctggtggtggtctccgtcggtctgtat
gtcttcatgaacaagaagacctatgcccaccgctatatcttccccggtgtggccggcatg
gttgtttttatcatcttccctcttgcctacacgatcggcatcgccttcaccaactattcg
ggatccaacctgctctccatcgagcaggcgcgagattaccatctgaaaaaaacctacaag
gtggcgggcggtgaattcgatttcaccctcttgggtggtgagaacaatcagtttcagctg
ctgctgaaacaggacgaccaatcctttatcagtcaacccgttaccctgatgagcaacaag
gcccgtgaactggctgtccgtgagggcagagtccatgaaccggtgcaggttgttcagctg
caacacctggaaggggaggccgtggacaaggtggcacccatccgggccatcgtcgaccat
cgcactcacctgagcgcactcgatctggtgctgccggatggcggaacccacctgaccctg
agcagcctgcgcaagttcgccgcccagaagcagcagtacacccgtctgctggacggtgcc
gtgctcaagtccggggtggtgatcaaagacagcaacctgctgcgtgacaaccagagcggc
gagctgatgctgcccaacggcgacaccggcttctatcaatacatcgacgagcagggccag
tttgtcggcaagagcgtggcgccaggtttcgtggtgagcgtgggctggaagaacttcgcc
cgcatcgtcaccgatccgggtatccaggcaccgttcctgcagatcttcatctggaccgtg
atcttctccgcctgttcggtgggcttcaccctggccatcggcatggtgctggcctgtctg
gtgcagtgggagtccctcaaggggcgcggtttctaccgggtcatgctgatcctgccctat
gccatcccggcgttcatctccatcctggtgttcaagggcttgttcaaccagaacttcggt
gagatcaacctgttcctggaagcggcgttcggcatcaagccggactggtataccaacccc
ttcctagccaaggtgatgatcctcatcgtcaatacctggcttggctacccctacatgatg
atcctctgcatgggcctgctcaaggccattccggaagatctctatgaagcgtccgccatg
gacggtgccggtccggtgcagaacttcttcaagatcaccgtgccgctcttgatgaagccg
ctgacgccgctgttgattgcctcgttcgcgttcaacttcaacaacttcgtgctcatccag
ttgttgaccaacggcgcgccggacatcataggcgccagcaccccggccggtaccaccgac
ttgctggtgagctacacctaccggatcgcgttccagggctcgggtggtcaggactacggt
ctggccagtgccatcgccaccgccatcttcctcatcgtgggtgcgctggccttgctcaac
ctgaaattgtccaaagccgacaagcaactgtaa

DBGET integrated database retrieval system