KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1827
Entry
AHA_1827          CDS       T00424                                 

Definition
(RefSeq) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AHA_1827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aha02044]
    AHA_1827
Secretion system [BR:aha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AHA_1827
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 Phage_Mu_Gp45 DUF2917
Other DBs
NCBI-GeneID: 4488279
NCBI-ProteinID: YP_856361
UniProt: A0KJB0
Position
1991311..1993542
AA seq 743 aa
MADSTGLQFTVKVGALPESTFVVAEFALDEALNRPFNLRLELASAQPDIDFGAVLDQPCE
LLVWYNGELQRRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNCRIFQAQKPDEI
LSILLQEHGITDYAFALKNEHAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRI
VFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSCKTPAYGLSH
KKQGSELEHQRDTYQHFDYPGRYKQDPSGKAFAQHRLDALRNDAVAGQVKSNCAALLPGQ
TFSLTEHPNGSLNTDWQIVRIRHTGEQPQALEEEGGSGPTVYHNEFGVVKASTTWRARIG
SPEAPHKPMVDGPQIAMVVGPDGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETH
QGEGFNELRFEDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRVRKVPG
EEGAPPSLGNDHLTVEGEKRDHIKADYSLTVDTSMHQKLGQSWLTQAGQEVHVKAGAKVV
LEAGSEITVKVGGCFIKVDGGGVTLVGPTIKMNSGGNAGSGSGWAGKVPKSMEGMLDSPH
TRWMKFYHLDSELMPLAGTPYKAVLSDGSVREGTLDGEGMALLEDVPAGTASVTYDLQDT
FADLPRESISALTGHLDSLSDEG
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggcagacagcacaggattacaatttaccgtcaaggtgggggctctgcccgagagcacc
ttcgtggtggccgagtttgcgctggatgaagcgctcaaccgcccgttcaacctgcgtctg
gagctggcgagtgcccagcccgacatcgactttggcgccgtgctggaccagccgtgcgag
ctgctggtgtggtacaacggcgagctgcagcgccgggtctgcggggtggtgagtgacttc
gcgcagggtgacagcggctttcgccgcacccgctatcagctcatggtgcagccggccctg
tggcgactctctttgcgccaaaactgccgcatcttccaggcgcaaaagcccgatgaaatc
ctctccatcctgttgcaagagcacggcatcaccgactatgcctttgcgctcaagaacgag
catgccaagcgggagtactgcgttcagtaccgggaaaccgacctcgatttcgtgaaccgg
cttgccgccgaagaggggatgttctacttccacgagtttgaagcgggcaagcaccgcatc
gtgtttgccgacgacgcggccgctctgactgccggccccgagctcttcttcaacctcggc
aaccgttccctcgagcaaggcccctatgtgcggcagttccactaccgtgaggcagtgcgc
ccgtcggatgtggagctcaaagactacagctgcaagacgcctgcctacggcctctctcac
aaaaagcagggcagtgagctcgagcaccagcgcgacacctaccagcacttcgactatccg
ggccgctacaagcaggacccgagcggcaaggcgtttgcccagcataggctggatgcgctg
cgcaacgacgcggtggcgggccaggttaagtccaactgcgccgcgttgctgccgggccag
acgttttcactcactgaacatcccaacggcagcctcaacaccgactggcaaatcgtgcgt
atccgtcacaccggtgaacaaccccaggccttggaagaagaaggcggcagcggccccacc
gtctatcacaacgaatttggtgtagtgaaggccagcaccacctggcgggcgcgcatcggc
agtccggaggcccctcacaagcccatggtggatggcccgcaaatcgccatggtggtgggc
cccgacggggaagagatttactgcgacgagcacggccgggtgaagctgcaattcccgtgg
gaccgctacggctcgagcaacgaccagagctcctgctgggtgcgagtctcgcaaggctgg
gccggcggccaatacggcatgatggccatcccgcgcatcggccacgaggtcatcgtgagc
tttttggaaggggatccggaccagcccatcgtgaccgggcgcacctatcacgccaccaat
cggccaccgtacgagctgccagccaacaagacccgcaccgtgctgcgcaccgaaacccac
cagggtgagggcttcaacgagctgcgctttgaagaccaggctgggcaggaagagatttac
atccacggtcagaaagacctgaacgtgctgatagagaacgatgccgcttggcacatcaaa
catgaccagcacaccgacatcgacaacgagcgggtgacccgtgtcaggaaggtgccgggt
gaggaaggggccccacccagtcttggcaacgatcatctgaccgttgaaggagagaagcgg
gaccatatcaaggctgactactcgctgaccgtggatacctccatgcatcaaaaactcggt
cagagctggctcacccaggcggggcaggaagtgcacgtcaaagccggtgccaaggtggtg
ctggaagcgggttctgaaattaccgtcaaggtcggtggctgctttatcaaggttgatggc
ggcggtgtcaccctggtcggccccaccatcaagatgaattcgggtggcaatgcaggctct
ggatctggttgggctggcaaggtacccaagagcatggagggtatgctggacagccctcac
acacgctggatgaaattttatcacctcgactccgagctgatgccgctggcgggcaccccc
tacaaggccgtattgagcgatggttcggtgcgggaaggcacgctggatggtgagggcatg
gcgctgctcgaggatgtgcctgctggcaccgcctcagtgacctatgacctgcaggacact
tttgccgatctgccccgtgaatccatctcggccctcaccggccatctcgacagtctgagc
gacgagggctga

DBGET integrated database retrieval system