KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1930Help
Entry
AHA_1930          CDS       T00424                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00020  Citrate cycle (TCA cycle)
aha00640  Propanoate metabolism
aha00660  C5-Branched dibasic acid metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
Module
aha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHA_1930
   00640 Propanoate metabolism
    AHA_1930
   00660 C5-Branched dibasic acid metabolism
    AHA_1930
Enzymes [BR:aha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AHA_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 4488644
NCBI-ProteinID: YP_856461
UniProt: A0KJL0
Position
2108704..2109576
Genome map
AA seq 290 aa AA seqDB search
MSVLINKDTKVICQGFTGGQGTFHSEQAIAYGTQMVGGVSPGKGGTTHLGLPVFNTVRDA
VEATGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDMLDVKVKLQETGVRMI
GPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG
DPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGNAEEDAAAYIKAHVTKPVVSYIAGVTAP
AGKRMGHAGAIIAGGKGTAAEKFAALEDAGVKTVRSLADIGKALREVTGW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttctgatcaacaaagacaccaaggtgatctgccagggctttaccggcggtcag
ggcactttccactccgaacaggcgattgcctacggtacccagatggtcggtggcgtctcc
ccgggcaagggtggcaccactcacctgggcctgccggtgttcaacaccgtccgtgacgcc
gtggaagccaccggcgccactgcctccgtcatctatgtaccggccccgttctgcaaggac
gccatcctggaagccatcgatgccggcatcaagctcatcgtcaccatcaccgaaggcatc
ccgaccctggacatgctggacgtcaaggtgaagctgcaggaaaccggcgtgcgcatgatc
gggcccaactgcccgggcgtcatcaccccgggtgagtgcaagatcggcatcatgccaggc
cacatccacaagccgggcaaggtgggcatcgtctctcgctccggcaccctgacctatgaa
gcggtcaagcagactacggacgagggcttcggccagtccacctgcgtcggcatcggtggc
gatcccatcccgggttccaacttcatcgacatcctggagatgttccagaatgacccgcag
actgaagccatcgtgatgattggcgagatcggcggcaacgccgaggaagatgcggcggcc
tatatcaaggcccacgtcaccaagccggtggtctcctacatcgcgggtgtcaccgccccg
gctggcaagcgcatgggtcatgcgggcgccatcatcgccggtggtaaaggcaccgcggca
gagaaatttgccgccctggaagatgccggtgtgaaaaccgtgcgctccctggccgatatc
ggcaaggccctgcgtgaagtgaccggctggtaa

DBGET integrated database retrieval system