KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2143Help
Entry
AHA_2143          CDS       T00424                                 

Gene name
atoB
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00071  Fatty acid degradation
aha00072  Synthesis and degradation of ketone bodies
aha00280  Valine, leucine and isoleucine degradation
aha00310  Lysine degradation
aha00362  Benzoate degradation
aha00380  Tryptophan metabolism
aha00620  Pyruvate metabolism
aha00630  Glyoxylate and dicarboxylate metabolism
aha00640  Propanoate metabolism
aha00650  Butanoate metabolism
aha00900  Terpenoid backbone biosynthesis
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
aha01212  Fatty acid metabolism
aha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHA_2143 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AHA_2143 (atoB)
   00640 Propanoate metabolism
    AHA_2143 (atoB)
   00650 Butanoate metabolism
    AHA_2143 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AHA_2143 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AHA_2143 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AHA_2143 (atoB)
   00310 Lysine degradation
    AHA_2143 (atoB)
   00380 Tryptophan metabolism
    AHA_2143 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AHA_2143 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AHA_2143 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AHA_2143 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aha04147]
    AHA_2143 (atoB)
Enzymes [BR:aha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AHA_2143 (atoB)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHA_2143 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 4488432
NCBI-ProteinID: YP_856666
UniProt: A0KK65
Position
2344832..2345995
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGTLANLTAPELGACAIAAAMAEVGLRGEQIDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVNKVCGSGMKAVMLAADGLRLGDTKVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAVDTLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAAQLGLPVLARLVGYQSHAALPAEFTSAPIGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLKRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggaaccctg
gccaacctgacggcccccgaactgggcgcctgtgccattgctgcggccatggcagaggtg
gggctcaggggagagcagatcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgccaagcggtgctgaaggcgggcctgccggacagcattccctgc
accacggtcaacaaggtgtgcgggtccggcatgaaggcggtgatgctggcggccgatggg
ctacggctcggcgacaccaaggtggtgatcgccggcgggatggagagcatgagccgcgcc
ccctatctgctcgacaaggcgcgcagcggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacgggctgcaggatgcctacgaaggtcagctgatggggcattatgcc
cagctgagcgccgatcgcgccgggttgacccgtgccgatatggatgcttttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggggcctttgcggcggagctggcgcca
gtgatggccgtagataccctgctgctggccgaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagccggccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggctgcgctgatcctgatgcgctccgacactgccgcg
cagctggggctgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcgccgatcggggcaatcaagggcctgctggccaaggtgggttgg
cgggtggaggaggtggatttgttcgaggtcaacgaggcgtttgccatggtcagtctgctg
gcgatggccggttgccagctaccccatgacaaggtcaacgtgaatggcggcgcctgcgcg
ctcggtcatccgctgggggcgagtggcgccaggatcttggtgaccctgatccatgccttg
cgcgaacgcggtctcaaacgcggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggtcgccatcgagctgggttaa

DBGET integrated database retrieval system