KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2154Help
Entry
AHA_2154          CDS       T00424                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00071  Fatty acid degradation
aha00280  Valine, leucine and isoleucine degradation
aha00281  Geraniol degradation
aha00310  Lysine degradation
aha00362  Benzoate degradation
aha00380  Tryptophan metabolism
aha00410  beta-Alanine metabolism
aha00640  Propanoate metabolism
aha00650  Butanoate metabolism
aha00903  Limonene and pinene degradation
aha00930  Caprolactam degradation
aha01040  Biosynthesis of unsaturated fatty acids
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
aha01212  Fatty acid metabolism
Module
aha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AHA_2154 (fadJ)
   00650 Butanoate metabolism
    AHA_2154 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    AHA_2154 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    AHA_2154 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AHA_2154 (fadJ)
   00310 Lysine degradation
    AHA_2154 (fadJ)
   00380 Tryptophan metabolism
    AHA_2154 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHA_2154 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AHA_2154 (fadJ)
   00281 Geraniol degradation
    AHA_2154 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AHA_2154 (fadJ)
   00930 Caprolactam degradation
    AHA_2154 (fadJ)
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AHA_2154 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AHA_2154 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AHA_2154 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 4487970
NCBI-ProteinID: YP_856678
UniProt: A0KK77
Position
2359895..2362042
Genome map
AA seq 715 aa AA seqDB search
MSEKTFSLAVRQDGIGILTMDVPGESMNTLKAAFVEEIRAVLAEVKANKELIGLVVVSGK
KDSFIAGADISMLAACTSAKDAETLSREGQVIFAEIESLPIPVIAAIHGPCLGGGLELAL
ACHGRVVTDHGKTVLGLPEVQLGLLPGSGGTQRLPRLIGVAKALDLMLTGKQVRAKQAKK
LGLVDDVVPPSILLDAAIKLAKKGKPRHELKRDLQGKLLETNKLGRKVLFDQARKGVKAK
TRGNYPAPDLILEVVRIGVEEGMQAGLAAESRHFGELVMTAESAALRSIFFATTEMKKEV
TYQGAEPRKVGHAAVLGGGLMGGGIAFVTATKAGVPVRIKDVASSGIGNAMRYSYDILAK
KLKRRQLLRSELEKQMSLLTGTLDYSGFHRVDMVVEAVFEDLSLKHQMVKDVERECGEHT
VFASNTSSLPIHQIASVAAHPERVVGLHYFSPVDKMPLAEIIPHAGTSAETVATTLAFAR
AQGKTPIVVKDEAGFYVNRILAPYMNEAARLVLEGEPVEVLDGALLDFGFPVGPITLLDE
VGIDVGAKISPILEKELGGEQFQAPAAFNKLLQNDRKGRKNGKGFYLYGKAAPRSKLTGK
EGKKMVDESVYGVLGISPQAKLAKTELAERCVLMMLNEAAMALDSGVVASARDGDIGAIF
GIGFPPFLGGPFRYMDSLGIEHLVGRLEHYQKRYGDRFAPCDRLKAMAAEQQRFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagactttttccctggcggtgcgccaggatggcatcggcattctcaccatg
gatgtgccgggcgagagcatgaataccctcaaggccgcctttgtggaggagatccgcgcg
gtgctggccgaggtgaaagccaataaagagctgatcggcctggtggtggtctccggcaag
aaggactccttcatcgccggcgccgacatcagcatgctggcggcctgtaccagcgccaag
gatgccgagacgctgtcgcgggaagggcaggtgatcttcgccgagatcgagtcgctgccg
atcccggtgatcgccgccattcacggcccctgcctcggcggcgggctggagctggcgctg
gcctgccatggccgggtggtcaccgatcacggcaagacggtgctcggcctgcccgaggtg
caactgggcttgctgccgggctccggcgggacccagcgtctgccgcgcctcatcggggtg
gccaaggcgctcgatctgatgctgaccggcaagcaggtgcgggccaagcaggccaagaaa
ctggggctggtggacgacgtggtgccgccctccatcctgctggacgccgccatcaagttg
gccaagaagggcaagccccgtcacgagctcaagcgggatctgcagggcaagctgctggag
accaacaagcttggccgcaaggtgctgttcgatcaggcccgcaagggggtgaaggcgaag
acccgcggcaactacccggccccggatctgatcctggaagtggtgcgcatcggggtggaa
gaggggatgcaggccggccttgccgccgaatcccgccactttggcgagctggtgatgact
gctgagtccgccgccctgcgctccatcttctttgccaccaccgagatgaagaaggaggtc
acctatcagggggccgagccgcgcaaggtgggtcatgccgccgtgctgggcggtggtctg
atggggggcggcatcgccttcgtcaccgccaccaaggcaggcgtgccggtgcggatcaag
gacgtggccagcagcggcatcggcaatgccatgcgctacagctacgacatcctggccaag
aagctcaagcgccgccaactgctgcgcagcgagcttgagaagcagatgagcctgctgacc
ggcaccctcgactactccggtttccaccgggtcgacatggtggtggaggcggtgttcgaa
gatctttccctcaagcaccagatggtgaaggacgtggagcgcgagtgtggcgagcacacc
gtgttcgcctccaacacctcctctctgcctatccaccagatcgcctcggtggcggcgcac
ccggagcgggtggtggggctgcactacttcagcccggtggacaagatgccgctggcggag
atcatcccccacgccggcaccagtgccgagacggtcgctaccaccctggcctttgctcgc
gcccagggcaagacccccatcgtggtcaaggacgaggcgggcttctacgtcaaccgcatc
ctggccccctacatgaacgaggcggcgcgcctggtgctggaaggggagccggtggaggtg
ctggacggtgccctgctcgatttcggcttcccggtcggccccatcaccctgctggacgag
gtggggatcgacgtgggtgccaagatctccccgatcctcgaaaaagagctggggggcgag
cagttccaggccccggcggcctttaacaagctgctgcaaaacgatcgcaaggggcgcaag
aacggcaagggcttctacctctacggcaaggcggccccgcgcagcaagctcaccggcaaa
gagggcaagaagatggtggacgagagcgtctacggtgtgctcggcatctcgccccaggcc
aagctggccaagacggagctggccgagcgctgcgtgttgatgatgctcaacgaagcggcc
atggcgctggacagcggcgtggtggcctcggctcgcgatggcgacatcggcgccatcttc
ggcatcggcttcccgccgttcctgggtggcccgttccgctacatggacagcctcggcatc
gagcatctggtggggcgccttgagcactaccagaagcgctacggcgaccgcttcgccccc
tgcgatcgcctcaaggcgatggcagcggagcagcagcgcttctattga

DBGET integrated database retrieval system