KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2177
Entry
AHA_2177          CDS       T00424                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00230  Purine metabolism
aha01100  Metabolic pathways
aha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AHA_2177
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AHA_2177
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 4489994
NCBI-ProteinID: YP_856701
UniProt: A0KKA0
Position
2394101..2396419
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSSIAHGKVLTIDANEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAASALAEGAYPIHPTGNLLRQSQIRAGEPEQAIAAADLQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGTLGISRDGV
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELRLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRIINLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGAGEEQRHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgcttggcatgcgccacgccaagtacgtgcgaagctcc
atcgcccacggcaaggtgctcaccatcgatgccaacgaagcgctggccctgcacggggtc
gaagccgtgttcacccacgaggatgtgcccaccacctgttttcgcaccgccggccacgcc
tggtccctcgatgagaccaagcgggacgtgaaagaccgccgcctgctcaccgaccatgtg
cgccactttggcgatggcgtcgccatcgtggtggcccgcgatccgctggtcgccgagaag
gccgccgccctggtcaaggtgacctacgagccgctgccggtgatgacggatgcggccagc
gccctggccgagggggcttatcccatccacccaaccggcaacctgctgcgccagagccaa
atccgggcgggagagccggagcaggccatcgccgccgccgacttgcagttcaaggggcac
taccagacgccggtggtgcagcactgtcatctggagacggtgacctgttacgcctacatg
gatcagccggaccacatcatcgtcgtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaaatccctcggcttgccctggtccagcgtgcgggtgatcaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcgtttctgagc
tacaagctcggcggcgtgccggtcaaggtgaccttgagccgggaggagtgcttttttgct
tctcgtacccgccacggctttgccatcgacggcactcttggcatcagccgggatggcgtg
ctcaaggggtatcagctggacgtgctctccaacaccggcggctatgcctcccacggtcac
tccatcgccagcgccggcgccaacaagataagctacctctatccgcgcagcgcctttggc
tatgacgccaaaaccttctacagcaacctgcccaccgccggtgccatgcgcggttacggc
gcgccccaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagctgcga
ctcgacccgcttgcggtgcgcatcgccaacgtggcccgcgagggggatgtcaatcaggtc
aaccagaagaccatctacagcgcagggctccctgagtgcctgcgccggggtggcgagcag
ttcgagtgggagcggctcaaggccgagtgtctggcgcaggatccggcgagccgggtacgg
cgcggcatcggggtggcgtgttttagctatggctccaacacctatccggtgggggtggag
atcgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcaggggtcggacaccgtctttgcccagatggcggcccagaccttaggc
attccgtttgagcagatccgggtcatctcgacccaggataccgacattaccgcctacgat
ccgggctcattcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagctgcgggcccgcatcctctcgctggcggcccagctctgccatcaggatgtgggg
tcgctcaccctgatcgatggctacgtggtgctggcgggtgcaccggacaaggtgctcatc
agcgtcgccgaggtgtcggtcaacgcctactaccacctcaccatcggcggccagatcacc
tccgaggtctcccacaagaccaccaccaacccgccgagctttggctgcaccttcgtcgat
ctcagtgtcgacatcgatctctgcaaggtgaccatcaatcgcatcatcaacctgcacgat
gcgggcaagatcctcaacccgcagctggcggaggggcaggtgcacggcggcatggggatg
gggatcggctggtcgctgttcgaggagatgatcatcgacgccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgcccgagctcgagtgc
gactttgtacagacctacgagccccagtcggtctatggccacaaatccctgggggaaccg
cccatcatctcgccgggcccggcgatccgtaacgccattcgcatggcgaccggggtcgcc
atcaacgagctgcccatcacccccaagaccctgtttcgggagtttgtcgcggcgggtctg
attggcgagggagcaggggaggaacaacgccatgtttga

DBGET integrated database retrieval system