KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2179
Entry
AHA_2179          CDS       T00424                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00230  Purine metabolism
aha01100  Metabolic pathways
aha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AHA_2179
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 4489996
NCBI-ProteinID: YP_856703
UniProt: A0KKA2
Position
2397287..2397772
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERKGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLSEAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaagcct
tactcctacgcggtgtcgcccaccatgtcgctgcttcacttcctgcgcgggcaggggctg
atcagcgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcacggccatcgacagctgcctctatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggggagcgtaaggggaatgagctctccgacgtgcaacaggcctttatcgac
gagggggcggtgcagtgcggcttttgcaccccgggattggtcatggcgagcgccgccctg
ctcgacaagacagagcgccgtcccttgagcgaggcggagatccgccgcggcctgtcgggg
aatctgtgccgctgcaccggttatcagaacgtggtgcgggcggtgaaaaagtgctgcaag
gggtga

DBGET integrated database retrieval system