KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2578Help
Entry
AHA_2578          CDS       T00424                                 

Definition
(RefSeq) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00860  Porphyrin and chlorophyll metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
Module
aha_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AHA_2578
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     AHA_2578
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     AHA_2578
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     AHA_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-GeneID: 4490900
NCBI-ProteinID: YP_857088
UniProt: A0KLD7
Position
2872003..2873394
Genome map
AA seq 463 aa AA seqDB search
MDFLPLFCQLQHKPVLIVGGGEVAVRKARLLLDAKARVTINAPHLEPQLMSWAEQGLLTV
CAADFHPELLDGKWLVIAATNQPEVNQQVFNEANRRQIFCNVVDSPAHCSAIMPAIIDRS
PLMVAISSAGSAPLLSRQLREKIEALLPQHLGQLATLAGKLRERVKAIPDKLARRRFWER
LFSHERLACQLARGQQQAAEESVAELLNEPQQSKGSVTLVGAGPGDAGLLTLNGLQQLQQ
ADVVVYDRLVSQEVLAHVRRDAERIFVGKEAGCHCVPQQAINQLLLEQARLGKQVVRLKG
GDPFIFGRGGEELETLAEAGIPFSVVPGITAASGCAAYSGIPLTHRDHAQRVQFITGHDK
EGNIAQEWPALATPRQTLVFYMGLAHAGRIQDELQTHGLPGHTPVALVEQGTRLQQRVVR
GKLQQLAQLATQVESPSLIIIGSVVTLADKLDWYGEANTLAGV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggactttctccctctcttctgtcagctgcaacacaagccggtgcttatcgtcggtggt
ggcgaagtcgctgtgcgcaaggcgcgcctgctgctcgatgccaaagcccgggtgaccatc
aatgccccccatctcgagccccagctgatgagctgggccgagcagggactgctcacggtc
tgcgccgccgactttcaccccgagctgctcgatggcaaatggctggtgatcgccgccacc
aaccagcccgaggtcaatcagcaggttttcaacgaagcgaatcggcgccagatcttctgc
aacgtggtggactctccggcccactgcagcgccatcatgcccgccatcatcgaccgctcg
ccgctgatggtggccatctccagcgcaggttcggcgccgctactgagccgccagctgcgg
gagaaaatcgaagccctgctgccgcaacacctcggccagctcgctaccctggcgggcaag
ctgcgcgagcgggtcaaggccataccggacaaactggcccgccgccgcttctgggagcgg
ctctttagccatgagcgactggcatgccagctggcgcggggccagcagcaggctgccgaa
gagagcgtcgccgagctattgaatgagccacaacagagcaaggggagcgtgacgctggtg
ggggctggccccggcgatgctggcttgctcaccctgaacggcttgcagcagctgcaacag
gcggatgtggtggtctatgaccggctggtgtcgcaggaggtgctggcacatgtgcgccgg
gatgccgagcggatctttgtcggcaaggaggcgggttgccactgcgtgccccagcaggcg
atcaaccagctgttgctggagcaggctcgcctcggcaaacaggtggtcaggctcaagggg
ggcgatccctttatctttggccggggcggcgaggagctggagaccctggccgaggcgggc
atccccttctcggtggtaccgggcatcacggctgcgtcgggctgcgccgcttacagcggc
attcccctcacccaccgcgatcacgcccagcgggtgcagttcatcaccggccacgacaag
gagggcaatatcgctcaggagtggccggcgctggcgaccccccgccagaccctggtcttc
tacatggggctggcccatgccggccgcattcaggacgagctgcagactcacggcctgccc
ggccacaccccggtagcgttggtggaacagggcacccgcctgcagcagcgggtggtacgc
ggcaagctgcagcagttggcgcagctggccactcaggtggagagcccaagcctgatcatc
atcggctcggtggtgaccctggcagacaagctggactggtacggcgaagccaataccctg
gccggagtgtaa

DBGET integrated database retrieval system