KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3421Help
Entry
AHA_3421          CDS       T00424                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00330  Arginine and proline metabolism
aha00332  Carbapenem biosynthesis
aha01100  Metabolic pathways
aha01130  Biosynthesis of antibiotics
aha01230  Biosynthesis of amino acids
Module
aha_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AHA_3421 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AHA_3421 (proB)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AHA_3421 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 4487147
NCBI-ProteinID: YP_857910
UniProt: A0KNQ9
Position
complement(3848364..3849467)
Genome map
AA seq 367 aa AA seqDB search
MENRTIVVKLGTSVLTGGSSQLNRAHMVELVRQCAALHRHGHRVVVVTSGAIAAGREHLG
HPPLAPTLPNKQMLAAVGQTQLIRVWQDLFNLYGLHIGQMLLTRADLEDRERYLNARDTL
RTLLDHRIIPVINENDAVATAEIKVGDNDNLSARAAILADADLLILLTDQKGLFTADPRT
NPDAQLIEEVQTIDDTLRKLAGDSVSGLGTGGMATKLQAADVARRAGVNVVIATGQMPEV
VGRLAKGERIGTLFPALASPLEGRKSWILAGPPPHGEVQVDQGAVAAMQEKGSSLLPKGI
VAVKGDFVRGDVVRILDPKGAELARGICRYNHLELDKLRGVHSDNIEQVLGYGYGAVAIH
RDDMVLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagaaccatagtcgtcaaactgggcaccagcgtgctcaccgggggatcttcc
cagctcaatcgtgcccacatggtcgagctggtcagacagtgtgcagccttgcaccgtcac
ggccacagggtcgtagtggtcacctcgggggccattgcggccggccgtgagcatctgggc
caccctccattggcgccaaccctgcccaacaagcagatgctggcggccgtcggccagacc
cagctgatccgggtatggcaggatctgttcaacctctatgggctgcacatcggtcaaatg
ctgctgacccgcgccgatcttgaagatcgcgagcgttacctcaatgcccgcgacaccctg
cggaccctgctcgatcaccgcatcatcccggtcatcaacgagaacgacgcggtggcgact
gccgaaatcaaggtaggggacaacgacaacctctccgctcgcgccgccattttggccgat
gcggatctgctgatcctgctcaccgaccagaaggggctgtttaccgccgatccccgtacc
aacccggatgcccagctcatcgaagaggtacagaccatcgacgacaccctgcgcaagctg
gcgggtgacagcgtcagcgggctcggtaccggcggcatggccaccaagctgcaggccgcc
gacgtggcgcgccgggccggcgtcaacgtggtgatcgccaccggccagatgccggaagtg
gtcggccgtctcgccaagggcgagcgcatcggcaccctgttcccggcgctggcgtcgccg
ctggaagggcgcaagagctggatcctggcagggcctcctccccacggcgaagtgcaggtg
gatcagggcgccgtggccgccatgcaggagaagggctccagcctgctgcccaagggcata
gtggcggttaagggcgatttcgtacgtggcgacgtggtgcgcattctcgaccccaagggt
gccgagctggcgcgcggcatctgccgttacaatcatctggagctggacaagctgcgcggc
gtccattcggacaacatcgagcaggtgctgggttacggctatggcgccgtggccatccac
cgcgacgacatggtgctgctgtga

DBGET integrated database retrieval system