KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3499Help
Entry
AHA_3499          CDS       T00424                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00040  Pentose and glucuronate interconversions
aha00052  Galactose metabolism
aha00500  Starch and sucrose metabolism
aha00520  Amino sugar and nucleotide sugar metabolism
aha01100  Metabolic pathways
aha01130  Biosynthesis of antibiotics
Module
aha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AHA_3499 (galU)
   00052 Galactose metabolism
    AHA_3499 (galU)
   00500 Starch and sucrose metabolism
    AHA_3499 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AHA_3499 (galU)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AHA_3499 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 4490429
NCBI-ProteinID: YP_857973
UniProt: A0KNX2
Position
3937685..3938578
Genome map
AA seq 297 aa AA seqDB search
MVRKAVLPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVREAIAAGIKEIILVTHSSKN
SIENHFDKSFELEATLEKRVKRQLLEEVQHICPKDVTIMHVRQGEAKGLGHAVLCARPLI
GDNPFAVLLPDVLIDEVASNPKQDNLAEMVHMFEEDHISQIMVEAVPESEVDKYGIADIK
GEALSEGMSLPMQAIVEKPPRDEAPSNLAVVGRYVLSSNIWPLLEKTPAGAGDEIQLTDA
IAMLMEQEQVNAYFMKGRSHDCGSKFGYMKANVEYAVRHPELNGEFIIWLKQFAKQL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgcaaagccgttcttcccgtcgccggtctgggcacccgcatgttgccagccacc
aaggccatccccaaggagatgctgcccgtcgtcgacaaaccgctgatccagtatgtagtg
cgcgaagccatcgccgccggcatcaaggagatcatcctggtcacccactcgagcaagaac
tccatcgaaaaccacttcgacaagagcttcgagctggaagcgaccctcgagaagcgggtc
aagcggcaactgctggaagaggtgcaacacatctgcccgaaagacgtcaccatcatgcac
gtccgccagggggaagccaaaggtctggggcacgcggtgctctgcgcccgcccgctgatc
ggcgacaacccgtttgcggtattgctgccggacgtgctgatcgacgaggtggccagcaat
cccaagcaggacaacctggccgagatggtgcacatgttcgaagaggatcacatcagccag
atcatggtggaagccgtccccgagagtgaagtggacaaatacggcatcgccgacatcaag
ggagaagctctgagcgagggcatgtctctgccgatgcaggccatcgttgagaaacccccc
cgtgacgaggccccctccaatctggccgtggtcggccgttacgtgctctcttccaacatc
tggccgctgctagagaagacccccgccggtgccggcgacgagatccagctgaccgatgcc
atcgccatgctgatggagcaggagcaggtgaatgcctacttcatgaaagggcgcagccac
gactgcggtagcaagttcggttacatgaaagccaacgtggaatatgcagtgcgccatccg
gaactgaacggcgaatttatcatttggttgaaacagtttgccaagcagctgtaa

DBGET integrated database retrieval system