KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3669
Entry
AHA_3669          CDS       T00424                                 

Definition
(RefSeq) SmtA protein
  KO
K15460  tRNA1Val (adenine37-N6)-methyltransferase [EC:2.1.1.223]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
KEGG Orthology (KO) [BR:aha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aha03016]
    AHA_3669
Enzymes [BR:aha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.223  tRNA1Val (adenine37-N6)-methyltransferase
     AHA_3669
Transfer RNA biogenesis [BR:aha03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    AHA_3669
SSDB
Motif
Pfam: MTS Methyltransf_25 Methyltransf_3 Methyltransf_31 Methyltransf_11 PrmA PCMT Methyltransf_23 UPF0020 Methyltransf_12 Cons_hypoth95 PRMT5 GidB Methyltransf_18 Methyltransf_32 CMAS RrnaAD Methyltransf_4 Methyltransf_16 Methyltransf_24
Other DBs
NCBI-GeneID: 4487751
NCBI-ProteinID: YP_858125
UniProt: A0KPC4
Position
4100317..4101027
AA seq 236 aa
MGRNSGFTFKQFHVDHDRCAMKVGTDGILLGAWAPVTNARRVLDIGSGSGLIALMLAQRS
PADCRIDAVELDSNAARQARENAAASPWHERVTVIESAIQTYQATPYDLIVSNPPYFVAG
QSFRDPARALARHTGGLDSRDLLAACDRLLAPNGEVALVVPTAMADEILCISADYDLHAV
CYTAVITRAGKEANRVLLRLGRGLNKCEQGEIVIHSADGTYSDRYIQLTSPFYLKM
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggacgaaacagcggttttaccttcaagcaatttcacgtcgatcacgatcgctgcgcc
atgaaagtcggcaccgatggcatcctgctcggcgcctgggcacctgtcaccaacgcccgc
cgggtgctcgacattggcagcggcagcggcctcatcgccctgatgctggcccagcgcagc
cctgccgactgccgcatcgatgcggtagagctggatagcaatgcagcccggcaggctcgc
gagaatgcggcagcctccccctggcatgagcgggtcaccgtcatcgagagtgccattcaa
acctatcaggccaccccttacgatctcatcgtctccaacccgccctacttcgtggcgggc
cagtcatttcgcgatccggccagggcactggcacgtcataccggcggcctcgacagccgg
gatctgctggccgcctgtgaccgactattggcccccaacggcgaggttgcgctggtcgtg
ccaacggccatggccgatgaaattttatgcatctcggcggattatgatctgcacgccgtt
tgttatacagctgttatcaccagagctggaaaagaggcaaatcgtgttttattgcgactt
ggcagaggattaaacaagtgtgagcagggtgaaattgtgatccattctgctgatggaacc
tattccgacagatacatccaactaaccagccccttctatttgaagatgtaa

DBGET integrated database retrieval system