KEGG   Aeromonas hydrophila YL17: AI20_07745Help
Entry
AI20_07745        CDS       T03186                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00071  Fatty acid degradation
ahd00072  Synthesis and degradation of ketone bodies
ahd00280  Valine, leucine and isoleucine degradation
ahd00310  Lysine degradation
ahd00362  Benzoate degradation
ahd00380  Tryptophan metabolism
ahd00620  Pyruvate metabolism
ahd00630  Glyoxylate and dicarboxylate metabolism
ahd00640  Propanoate metabolism
ahd00650  Butanoate metabolism
ahd00900  Terpenoid backbone biosynthesis
ahd01100  Metabolic pathways
ahd01110  Biosynthesis of secondary metabolites
ahd01120  Microbial metabolism in diverse environments
ahd01130  Biosynthesis of antibiotics
ahd01200  Carbon metabolism
ahd01212  Fatty acid metabolism
ahd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AI20_07745
   00630 Glyoxylate and dicarboxylate metabolism
    AI20_07745
   00640 Propanoate metabolism
    AI20_07745
   00650 Butanoate metabolism
    AI20_07745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AI20_07745
   00072 Synthesis and degradation of ketone bodies
    AI20_07745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AI20_07745
   00310 Lysine degradation
    AI20_07745
   00380 Tryptophan metabolism
    AI20_07745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AI20_07745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AI20_07745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AI20_07745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahd04147]
    AI20_07745
Enzymes [BR:ahd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AI20_07745
Exosome [BR:ahd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AI20_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHV35081
Position
complement(3670607..3671770)
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLSAPELGACAIAAAMAQAGLKGEQIDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVNKVCGSGMKAVMLAADGLRLGDTNVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRSDMDAFAIT
SLERALAAQRSGAFAAELAPVKAGETLLLAEDEQPGKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRADTAAQLGVPVLARLVGYQSHAALPAEFTSAPIGAIEGLLAKVGW
QVGEVDLFEVNEAFAMVSMLAMAGCKLSHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLKRGIASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggcctttcaaggggccctg
gccaacctgagcgcacccgaactgggtgcctgtgccatcgccgcagccatggcgcaggcc
gggctcaagggggagcagatcgatgaggcttatcttggcaacgtgctgagtgccggggtc
ggccaggcgcccgcccgtcaggcggtgttgaaggcgggcctgccggacagcatcccctgc
accacggtcaacaaggtgtgtggttccggcatgaaggcggtgatgctggcggccgatggg
ttgcgactcggtgacacgaacgtggtgatcgccggcgggatggagagcatgagccgcgcc
ccttatctgctcgacaaggcgcgcagtggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacgggctgcaggatgcctacgaaggtcaactgatgggccattatgcc
cagctgagcgcggatcgtgccgggctgacccgctccgacatggatgcctttgccatcacc
tcgctggagcgggcgctggcggcccagcgcagcggcgcctttgcagcggagctggcgccg
gtcaaggccggagagaccctgctgttggccgaggatgagcagcctggcaaggcacgcccc
gagaagatcccccagctcaagccggctttcagcaagacgggcaccatcacggcggccaat
gccagctccatttcggacggggcggcggcgctgatcctgatgcgggccgacaccgccgcg
cagctcggcgtgcccgtgctggcacgactggtgggttatcagagccacgcggccctgcct
gccgagttcaccagcgcgcccatcggggccatcgagggcttgttggccaaggtgggctgg
caggtgggcgaggtggacctgttcgaggtcaacgaggcattcgccatggtgagcatgctg
gccatggcgggttgcaagctgtcccatgacaaggtgaacgtgaacggcggcgcctgtgcc
ctcggtcatccgctgggggcgagcggcgcccggatcctggtgaccctgatccacgccttg
cgcgaacgtggcctcaagcgcgggatcgccagtctgtgcatcgggggcggggaggcgacc
gcagtcgccatcgagctgggttaa

DBGET integrated database retrieval system