KEGG   Aeromonas hydrophila YL17: AI20_07920
Entry
AI20_07920        CDS       T03186                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00230  Purine metabolism
ahd01100  Metabolic pathways
ahd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AI20_07920
Enzymes [BR:ahd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AI20_07920
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AHV35114
Position
complement(3620808..3623126)
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSHIAHGKVLTIDASEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVSYEPLPVMTDARSALADDAHPIHPGGNLLRQSQIRAGEPEQAIAAADVQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSQKLGGVPVKVTLSREECFFASRTRHGFAIDGTLGINRDGT
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELGLDPLAVRIANVACEGDVNQVNQKTIYSAGLPECLRRGGEQ
FQWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRILNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGAGEEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgctcggcatgcgccacgccaaatacgtgcgaagccat
atcgcccacggcaaggtgctcaccatcgatgccagcgaggcgctggccctgcacggggtc
gaagccgtgttcactcacgaggatgtgcccaccacctgttttcgcaccgccggtcacgcc
tggtccctcgatgagaccaagcgggacgtgaaagaccggcgcctgctcaccgaccatgtg
cgtcacttcggcgatggcgtcgccatcgtggtggctcgcgatcccctggtcgccgagaag
gccgccgccctggtcaaggtgagctacgagccgctgccggtgatgacggatgcccggagt
gccctggctgacgatgcccaccccattcaccctggtggcaacctgctgcgccagagccag
atccgggcgggggagccggagcaggccatcgctgcggctgatgttcagttcaaaggccac
tatcagacgccggtggtgcagcactgtcatctggagacggtgacctgctacgcctacatg
gatcagccggaccacatcatcgtcgtcaccagcacccagatcccccagatagtgcgcagc
cgggtggccaagtccctcggcctgccctggtccagcgtgcgggttatcaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcgtttctgagc
caaaagctcggcggcgtgccggtcaaggtgacgctgagccgggaggagtgtttctttgct
tcccgcacccgccacggttttgccatcgacggcaccctcggtatcaaccgggatggcacc
ctcaaggggtatcagctggacgtgctctccaacaccggcggctatgcctcccacggccac
tctatcgccagcgccggcgccaacaagataagctacctctatccgcgcagcgcctttggc
tatgacgccaagaccttctacagcaatttgcccaccgccggtgccatgcgtggttacggc
gcgccgcaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagctgggt
ctggatccgcttgcagtgcgcatcgccaacgtggcctgcgagggggacgtcaatcaggtc
aaccagaagaccatctacagcgcagggctccctgagtgcctgcgccggggcggcgagcag
ttccagtgggagcggctcaaggccgagtgtctggcacaggatccggcgagccgggtacgg
cgcggcatcggggtggcgtgcttcagttatggatccaacacctatccggtgggggtggag
atcgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcagggatcggacaccgtctttgcccagatggcggcccagaccttaggc
attccgtttgagcagatccgggtcatatcgacccaggataccgacatcaccgcctacgat
ccgggctcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagttgcgggcccgtatcctctcgctggcagcccagctctgccatcaggatgtgggg
tcgctgaccctgatcgacggttacgtggtgctggcgggtgcgccggacaaggtgctcatc
agcgtcgccgaggtgtcggtcaacgcctattaccacctcaccatcggcggccagatcacc
tcggaggtctcccacaagaccaccaccaacccgccgagctttggctgcaccttcgtcgat
ctcagtgtcgacatcgatctctgcaaggtgaccatcaatcgcatcctcaacctgcacgat
gcgggcaagatcctcaatccgcagctggcagaggggcaggtgcatggcggcatggggatg
gggatcggctggtccctgttcgaggagatgatcatcgacgccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccctaccatgctggacttgcccgagcttgaatgc
gacttcgtgcagacctacgagccccagtcggtctatggccacaaatctttgggggagccg
cccatcatctcgccgggccccgctatccgtaacgccattcgcatggcgaccggtgtggcc
atcaacgagctgcctatcacccccaagaccctgttccgggagtttgtcgcggcgggtttg
attggcgagggagcaggggaggagcaacaccatgtttga

DBGET integrated database retrieval system