KEGG   Aeromonas hydrophila YL17: AI20_07930
Entry
AI20_07930        CDS       T03186                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00230  Purine metabolism
ahd01100  Metabolic pathways
ahd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AI20_07930
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AHV35116
Position
complement(3619455..3619940)
AA seq 161 aa
MMQPQSCPAVEIQCEINGKPYSYAVPPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GVALDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTDRRPLTEAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccgctgtggagatccagtgcgagatcaacggcaagcct
tactcctatgctgtgccgcccaccatgtcgctgcttcacttcctgcgcgggcaggggctc
atcagcgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcgtggccctcgacagctgcctctatctggcggtatgggccgatggcaaatccattcgc
accgtggagggggagcggcagggcaatgagctctccgacgtgcaacaggcctttatcgac
gagggggcggtgcagtgcggcttttgcaccccggggttggtgatggcgagcgcggccctg
ctcgacaagacagatcgccgacccttgaccgaggcggagatccgccgcgggctgtcgggg
aatctgtgccgctgcaccggctatcagaacgtggtgcgggcggtgaagaagtgctgcaaa
gggtga

DBGET integrated database retrieval system